Return to flip book view

Message

Written by Elizabeth Leigh Scagel and Rebecca Shivone Smith Teacher Instructions by Megan Schmitt A special thanks to the classroom teachers, reading specialists, special education teachers and our children for their valuable input and contributions to the writing of this curriculum. Classical School Solutions©2025 Classical School Solutions|classicalschoolsolutions.com All rights reserved

This book belongs to:

IINTRODUCTION1HOW TO USE THIS GUIDE3READERS IN RHYME SCOPE AND SEQUENCE4PHONOGRAM LIST8LESSON 1: AY Reader suggestion: 41-Fickle Fay•Teacher Notes Lesson 1A, 1B, 1C, 1D10•Nursery Rhyme: “Tom, Tom the pipers son”17•Picture Study: Teaching the Dolls-Inez Topham27LESSON 2: AI Reader suggestion: 42- Daisy May•Teacher Notes Lesson 2A, 2B, 2C, 2D29•Nursery Rhyme: “Johnny Shall Have A New Bonnet”36•Picture Study: His Book-Millicent Sowerby46LESSON 3: OY Reader suggestion: 43- Ahoy Roy•Teacher Notes Lesson 3A, 3B, 3C, 3D48•Nursery Rhyme: “Boys and Girls Come out to Play”55•Picture Study: Bobbin Rode a Rocking-Horse-Blanche Fisher Wright65LESSON 4: OI Reader suggestion: 44- Noisy Pigs•Teacher Notes Lesson 4A, 4B, 4C, 4D67•Nursery Rhyme: "The Clock”74•Picture Study: Dying the Cat-C. Coles Phillips84LESSON 5: EA Reader suggestion: 45-Ice Cream•Teacher Notes Lesson 23A, 23B, 23C, 23D86•Nursery Rhyme: “If All the World Was Apple Pie”93•Picture Study: Windy Day-Hilda Cowham103LESSON 6: AW Reader suggestion: 46-Paw Prints•Teacher Notes Lesson 6A, 6B, 6C, 6D105•Nursery Rhyme: “See Saw Margery Daw”112•Picture Study: Knit One Purr Two-Anne Anderson122

IILESSON 7: AU Reader suggestion: 47-Maude and Claude •Teacher Notes Lesson 25A, 25B, 25C, 25D124•Nursery Rhyme: “Sleep, Baby, Sleep”131•Picture Study: My Fairy Godmother-Hilda Cowham141LESSON 8: ED Reader suggestion: 48-Bonnie Saved Bunny•Teacher Notes Lesson 26A, 26B, 26C, 26D143•Nursery Rhyme: “A-Tisket, A-Tasket”150•Picture Study: Fairy Bread-Ruth Mary Hallock160LESSON 9: CH Reader suggestion: 49-Chet Chick•Teacher Notes Lesson 9A, 9B, 9C, 9D162•Nursery Rhyme: “Mary Had A Little Lamb”169•Picture Study: Wind in my Sails-Arthur A. Dixon179LESSON 10: NG Reader suggestion: 50-Long Way Home•Teacher Notes Lesson 10A, 10B, 10C, 10D181•Nursery Rhyme: “Billy, Billy, Come and Play”188•Picture Study: Shadow Puppets-Honor Appleton198LESSON 11: TCH. Reader suggestion: 51-Crosspatch•Teacher Notes Lesson 11A, 11B, 11C, 11D200•Nursery Rhyme: “Here We Sail So Fast and Free”207•Picture Study: Happy Notions-Jane A. Boyer217LESSON 12: Review OW, OU Reader suggestion: 52-Betty June•Teacher Notes Lesson 12A, 12B, 12C, 12D219•Nursery Rhyme: “There Was An Old Woman of Harrow”226•Picture Study: Grassy Places-Ruth Mary Hallock236LESSON 13: Review OA, OE Reader suggestion: 53-On The Rocks•Teacher Notes Lesson 13A, 13B, 13C, 13D238•Nursery Rhyme: “Hurry Up Engine”245•Picture Study: Mary’s Canary-Hilda Cowham255LESSON 14: Review AY, AI Reader suggestion: 54-Vain Mary Jane•Teacher Notes Lesson 14A, 14B, 14C, 14D257•Nursery Rhyme: “Minnie and Mattie”264•Picture Study: Poppies and Fairies-Margaret Tarrant274

IIILESSON 15: Review EA Reader suggestion: 55-Wee Goldfinch•Teacher Notes Lesson 15A, 15B, 15C, 15D276•Nursery Rhyme: “There are twelve months in all the year”283•Picture Study: The Blue Butterfly-Muriel Dawson293LESSON 16: Review CH, TCH Reader suggestion: 56-Wild Child •Teacher Notes Lesson 16A, 16B, 16C, 16D295•Poem: “The Dear Old Woman in the Lane”302•Picture Study: Fun With Chicks-Muriel Dawson312LESSON 17: UI Reader suggestion: 57-Fruity Folk•Teacher Notes Lesson 17A, 17B, 17C, 17D314•Nursery Rhyme: ““Bow-wow,” says the dog;”321•Picture Study: Thanksgiving Party-Frances Tipton Hunter331LESSON 18: EIGH Reader suggestion: 58-Little Red Hen•Teacher Notes Lesson 18A, 18B, 18C, 18D333•Nursery Rhyme: "Daffy Down Dilly”340•Picture Study: Give Thanks-Jessie Willcox Smith350LESSON 19: EY Reader suggestion: 59-Donkey Duke•Teacher Notes Lesson 13A, 13B, 13C, 13D353•Nursery Rhyme: “Doodle Doodle Doo”360•Picture Study: Flowers and Herbs Dugald Walker370LESSON 20: EI Reader suggestion: 60-Gingerbread Boy•Teacher Notes Lesson 14A, 14B, 14C, 14D372•Poem: “Who Has Seen the Wind” Christina Rossetti379•Picture Study: My Ball of Twine-Jessie Wilcox Smith389

1Welcome to Readers in Rhyme Language Arts program Level 2. This program is designed to ensure that learning phonics is enjoyable and easy for both teacher and student. At CSS our goal is to create beautiful, rich curriculum that is comprehensive but never overwhelming. Key Features: Scripted Lessons: Our Language Arts curriculum features step-by-step scripted lessons. Each lesson provides clear instructions, guiding you through the material easily. Open-and-Go Format: Easy prep and lesson planning. Multi-Sensory Approach: Listen, see and do. Engaging more than one sense at a time helps students process and retain what they are learning. Saying the phonogram sounds while tracing or writing, building words with magnetic letters or tiles, dictation etc. are just a few examples of this. While this approach is great for all students, it is especially helpful for children that struggle with learning to read. Color-coded phonograms aid with teaching and learning phonics: By using different colors to represent specific phonetic patterns or sounds, students can easily identify and recognize the patterns in words. This visual aid improves decoding skills, and assists in spelling. Red phonograms indicate the letter or letter group makes a vowel sound. Blue phonograms indicate the letter or letter group make a consonant sound. IntroductionPhonological and Phonemic Awareness Exercises: Help with developing crucial pre-reading and pre-writing skills. These exercises focus on recognizing and manipulating sounds in spoken language. These exercises are essential for early literacy development as they lay the foundation for reading and writing. Students learn to distinguish between different sounds, blend sounds together to form words, segment words into individual sounds, and manipulate sounds to create new words. These auditory based skills are a vital foundation for phonics instruction.

2Medial Sounds Say to the student: I’m going to say three words. Two of them will have the same MIDDLE sound. One of them will have a different middle sound. I want you to tell me which one is not like the others. Here is an example: beg, hit, met Beg and met both have the /e/ in the middle. Hit has an /i/ in the middle. Hit is not like the others. (It may be necessary to sound out the words slowly annunciating the vowel sound.)-Auditory Exercise-•hot, hat, mop •nap, slam, box •dig, top, dog •rod, sat, sock •bad, cup, map •mom, log, pinMastery Based Program: Our curriculum follows a carefully designed sequence, covering all essential phonics skills progressively. Each lesson builds upon the previous lesson and includes plenty of review. At Classical School Solutions, we strive to offer the best from the past in art and story. Our Readers In Rhyme feature beautiful vintage illustrations carefully restored alongside newly written stories. We hope the timeless themes of virtue in every day life inspire and delight your student. We are here to support you in any way we can. If you have questions, please feel free to contact us at info@classicalschoolsolutions.com. Or visit our website classicalschoolsolutions.com Happy reading! Example of auditory exercise found throughout this guide

31. Orient yourself to the flow of the pages and sequence of the activities. •Each lesson’s material is meant to be covered in one week. Each lesson is broken down into four days of teaching material in lessons A, B, C, and D. Day five of the school week is for review. Each daily lesson has activities that include phonics review and handwriting. •The nursery rhyme or poem should be read to the children daily and they can work on memorizing each one. •Phonics exercises can be done in various ways and ideas for activities can be found in teachers notes at the beginning of each lesson. 2. The teacher’s guide is scripted for your conversation with the students. • The phonics lesson in total should only last 20 minutes. Follow up work with letter tiles, chalkboard, whiteboard, etc will reinforce the concepts taught. 3. Initially, work slowly to orient the children to the material. • The goal of this program is to give children a solid phonics foundation. It is much easier to work steadily on mastery than it is to remediate skills later on that were not learned in these early years. Some students will catch on quickly and may need an option for independent work. 4. Incorporating Movement • Try to incorporate movement when possible. Have students clap out the syllables in words. Have them stand up to practice recitation of the poem they are memorizing. When the students practice handwriting have them say the sound(s) the phonogram makes while writing. 5. Repetition is Key • Do try to keep the same routine with the material. For those that are struggling this is very comforting. Practice makes progress!How To Use This Guide

4GOLDENROD SET - Books 1-101Hot DotCVC+Short O vowels2Fat CatCVC+Short A vowels3Big PigCVC+Short I vowels4Run SunCVC+Short U vowels, Third sound of O5Peg EggCVC+Short E vowels, Double Consonant GG6Top DogCVC+Short O vowels7Bad TadCVC+Short A vowels, Third sound of O8Will the PillCVC+Short I vowels, Second & Third sound of O, Second sound of E9Fun CubCVC+Short U vowels, Second & Third sound of O, Second sound of E10Wet PetCVC+Short E vowels, Second & Third sound of O, Second sound of E, Double Consonant SS11Clap for ClemCVC+Sounds of Vowels+Beginning Blends BL, BR, CL, CR, Double SS, LL12Fred FretsCVC+Sounds of Vowels+Beginning Blends DR, TR, FL, FR, Double SS, NN, LL13Glad GlenCVC+Sounds of Vowels+Beginning Blends GL, GR, PL, PR, Double SS, LL14Snug as a BugCVC+Sounds of Vowels+Beginning Blends SC, SK, SL, SN, Double SS, LL15Stop Don SopCVC+Sounds of Vowels+Sounds of Y+Beginning Blends SP, ST, SW, TW, Double SS, FF, LL16Hank’s PrankCVC+Sounds of Vowels+Beginning Blends+Ending Blends ND, NK, Double SS, LL17Romp & StompCVC+Sounds of Vowels+Sounds of Y+Beginning Blends+Ending Blends NT, FT, MP, LP, Double SS, NN, LL18Dust We MustCVC+Sounds of Vowels+Sounds of Y+Beginning Blends+Ending Blends ST, SK, LK, Double LL19Hog WildCVC+Sounds of Vowels+Beginning Blends+Ending Blends LD, LT, Double FF, LL20Plum BunsCVC+Sounds of Vowels+Sounds of Y+Review Beginning and Ending Blends, Double FFAPRICOT SET - Books 11-20

5TEAL SET - Books 21-3021Pam’s PramCVC+Sounds of Vowels+Review Beginning and Ending Blends22Clint and FlintCVC+Sounds of Vowels+Review Beginning and Ending Blends23See the BeesIntroducing Phonograms QU, EE24Seth and CassIntroducing Phonogram TH, Review Phonograms QU, EE25Wake Up JakeIntroducing Silent E, Review Phonograms QU, EE, TH26Shep & ShellyIntroducing Phonogram SH, Review Silent E, Review QU, EE, TH27Barb and CarlIntroducing Phonogram AR, Review “Silent E”, SH, QU, EE, TH28Lucky DuckIntroducing Phonogram CK, Review AR, “Silent E”, SH, QU, EE, TH29Hobby HorseIntroducing Phonogram OR, Review CK, AR, “Silent E”, SH, QU, EE, TH30By the BrookIntroducing Phonogram OO, Review OR, CK, AR, “Silent E”, SH, QU, EE, TH31Whale TaleIntroducing WH, Review OO, OR, CK, AR, “Silent E”, SH, QU, EE, TH32Little LadsIntroducing ER, Review QU, EE, TH, Silent E, SH, AR, CK, OR, OO33Sir RookIntroducing IR, Review QU, EE, TH, Silent E, SH, AR, CK, OR, OO, WH, ER34Turtle DoveIntroducing UR, Review EE, TH, Silent E, SH, AR, OR, OO, WH, ER, IR35Pop Pine ConeIntroducing WOR, EAR, Review QU, EE, TH, Silent E, AR, CK, OR, OO, WH, ER, IR36Fern and VernReview QU, EE, TH, SH, Silent E, AR, CK, OR, OO, WH, ER, IR, UR, WOR, EAR37Bow WowIntroducing OW, Review QU, EE, TH, SH, Silent E, AR, CK, OR, OO, WH, ER, IR, UR, WOR, EAR38Mouse HouseIntroducing OU, Review EE, TH, SH, Silent E, AR, CK, OR, OO, WH, ER, IR, WOR, EAR, OW39All AfloatIntroducing OA, Review EE, TH, SH, Silent E, AR, CK, OR, WH, IR, UR, WOR, OW, OU40Little Joe’s ToeIntroducing OE, Review EE, TH, SH, Silent E, AR, CK, OR, WH, IR, UR, WOR, OW, OUOLIVE SET - Books 31-40

6BLUEBONNET - Books 41-5041Fickle FayIntroducing AY, Review QU, EE, TH, SH, Silent E, AR, CK, OR, OO, WH, ER, IR, WOR, OW, OU, OA42Daisy MayIntroducing AI, Review QU, EE, TH, SH, Silent E, AR, CK, OR, OO, WH, ER, IR, OW, OU, OA, AY43Ahoy RoyIntroducing OY, Review QU, EE, TH, SH, Silent E, AR, CK, OR, OO, WH, ER, IR, OW, OU, OA, AY, AI44Noisy PigsIntroducing OI, Review QU, EE, TH, SH, Silent E, AR, CK, OR, OO, WH, ER, WOR, OW, OU, OA, AY, AI45Ice CreamIntroducing EA, (EE, TH, SH, Silent E, AR, CK, OR, OO, WH, ER, IR, UR, WOR, EAR, OW, OU, OA, AY, OY)46Paw PrintsIntroducing AW, (QU, EE, TH, SH, Silent E, AR, CK, OR, OO, WH, ER, IR, OU, OA, AY, AI, EA)47Maude & ClaudeIntroducing AU, (QU, EE, TH, SH, Silent E, AR, CK, OR, OO, WH, ER, EAR, OW, OU, OA, AY, AI, OY, EA)48Bonny Saved BunnyIntroducing ED, (QU, EE, TH, SH, Silent E, AR, CK, OR, OO, WH, ER, IR, UR, EAR, OW, OU, AY, AI, EA)49Chet ChickIntroducing CH, (QU, EE, TH, SH, AR, CK, OR, OO, WH, ER, IR, UR, WOR, OW, OU, OA, AY, AI, EA, ED)50Long Way HomeIntroducing NG, (EE, TH, SH, Silent E, AR, OO, WH, UR, WOR, OW, OU, OA, OE, AY, OI, EA, CH)51CrosspatchIntroducing TCH, (QU, EE, TH, SH, AR, CK, OR, OO, WH, ER, UR, EAR, OW, OU, OA, AY, EA, NG)52Betty JuneReview EE, TH, SH, AR, CK, OR, OO, WH, ER, IR, EAR, OW, OU, OE, AY, AI, OY, EA, AW, ED, CH, NG, TCH53On the RocksReview QU, EE, TH, SH, AR, CK, OR, OO, WH, UR, OW, OU, OA, OE, AY, EA, ED, CH, NG54Vain Mary Ja n eReview EE, TH, SH, AR, OR, OO, WH, UR, OW, OU, OA, OE, AY, EA, ED, CH, NG55Wee GoldfinchReview EE, TH, SH, AR, CK, OR, OO, WH, ER, OW, OU, OA, OE, AY, OI, EA, AW, CH, NG56Wild ChildReview EE, TH, SH, AR, CK, OR, OO, WH, ER, IR, EAR, OW, OU, OA, AY, AI, EA, NG, TCH57Fruity FolkReview EE, TH, SH, AR, OR, ER, OW, OU, OA, AY, AI, EA, AW, ED, CH, NG, UI58Little Red HenIntroducing EIGH, Review EE, TH, SH, CK, OO, WH, ER, WOR, OW, OU, AY, EA, ED, NG, TCH59Donkey DukeIntroducing EY, Review EE, TH, AR, CK, OO, WH, ER, UR, OW, AY, AI, NG60Gingerbread BoyIntroducing EI, Review TH, Silent E, SH, CK, ER, UR, OU, AY, AI, OY, EA, ED, TCHPLUM SET - Books 51-60

7SILVER SET - Books 61-7061Biggie WiggieIntroducing IE, (EE, TH, SH, AR, OR, OO, WH, ER, OW, OU, AI, EA, AW, ED, CH, NG)62OutfoxedIntroducing IGH, (QU, EE, TH, SH, AR, CK, OR, OO, WH, ER, WOR, OW, OU, AY, AI, OI, EA, AW, NG, TCH, IE)63Three KittensIntroducing EW, (EE, TH, SH, AR, OO, WH, ER, UR, OW, OU, OI, EA, ED, CH, NG, TCH, EY, EI, IE, IGH)64Billy Goats GruffIntroducing DGE, (EE, TH, SH, AR, OO, IR, OU, OA, AY, OI, EA, AW, ED, NG, EY, EI, IGH)65Lion & MouseIntroducing KN, GN, (QU, EE, TH, SH, AR, CK, OR, OO, WH, ER, UR, EAR, OU, OA, AY, AI, EA, AW, ED, CH, NG, EY, IE, IGH, EW)66Chicken LittleIntroducing GU, (QU, TH, SH, AR, CK, OR, OO, WH, ER, UR, EAR, OW, OU, AY, AI, OI, EA, AW, ED, CH, NG, EY, KN)67Wee RabbitIntroducing WR, (QU, EE, TH, SH, CK, OR, OO, WH, ER, EAR, OW, OU, OE, AY, AI, OI, EA, AW, ED, CH, NG, IGH, EW)68Mother GooseIntroducing OUGH, (EE, TH, SH, AR, CK, OR, OO, WH, ER, EAR, OW, OU, AY, AI, OI, EA, AW, ED, CH, NG, EY, IE, IGH, EW, KN)69Home at LastIntroducing TI, (EE, TH, SH, AR, CK, OR, OO, WH, ER, IR, OW, OU, OA, AY, EA, AW, ED, CH, NG, EY, EI, IE, KN, GN, WR, OUGH)70Flee the BeeIntroducing SI, (EE, TH, SH, AR, OR, OO, ER, UR, OW, OU, OA, OE, AY, AI, OY, EA, AW, AU, ED, NG, TCH, EY, IE, EW)71Robin & WrenIntroducing CI, (QU, EE, TH, SH, AR, CK, OR, WH, ER, IR, OW, OU, AY, AI, OY, EA, AW, ED, CH, NG, TCH, IE, IGH, EW, KN, WR, OUGH)72Brown HenQU, EE, TH, SH, AR, CK, OR, OO, WH, ER, OW, OU, OA, AY, EA, AW, AU, ED, CH, NG, EY, EI, KN, OUGH73Mouse TaleEE, TH, SH, AR, CK, OR, OO, WH, ER, WOR, OW, OU, OE, AY, AI, EA, ED, CH, IE, OUGH74GoldenhairEE, TH, SH, AR, CK, OR, OO, WH, ER, IR, OW, OU, AY, AI, EA, AW, ED, CH, NG, EY, EI, IE, IGH, DGE, OUGH75Chicken ScratchEE, TH, SH, AR, CK, OR, OO, ER, OW, OU, OA, AY, OI, EA, AW, ED, CH, NG, TCH, IE, IGH, EW76Clever PigEE, TH, AR, CK, OO, ER, OW, OU, AY, AI, OI, EA, AW, EY, IE, EW77BluebirdEE, TH, SH, AR, OR, OO, WH, ER, IR, UR, WOR, EAR, OW, OU, AY, AI, EA, AW, AU, ED, NG, TCH, EY, IE, IGH, EW, DGE, KN, OUGH78Jack-o-LanternQU, EE, TH, SH, AR, CK, OR, OO, WH, ER, EAR, OW, OU, AY, AI, OY, EA, AW, ED, CH, NG, EY, EI, IE, IGH, GU, OUGH79Little Girl BlueQU, EE, TH, SH, AR, CK, OR, OO, WH, IR, WOR, EAR, OW, OU, AY, AI, EA, AW, ED, CH, NG, TCH, EY, EI, IE, IGH, KN, OUGH80Stars in the SkyEE, TH, SH, AR, CK, OR, OO, WH, ER, UR, OW, OU, OA, AY, AI, EA, AW, ED, CH, NG, EY, IE, IGH, EW, KN, OUGHCHERRY SET - Books 71-80

©2025 Classical School Solutions8Readers In Rhyme72 Phonograms1c/k/ /s/cat, city2o/o/ /O/ /oo/u/not, no, too, love3g/g/ /j/go, gem4d/d/did5a/a/ /A/ /ah/bat, base, ball6s/s/ /z/sit, is7f/f/fun8qu/kw/quit9i/i/ /I/ /E/it, ice, ski10r/r/run11n/n/no12m/m/mat13u/u/ /U/ /OO/up, cute, put14y/y/ /i/ /I/ /E/yes, gym, my, baby 15j/j/jump16p/p/pet17e/e/ /E/met, me18z/z/zoo19l/l/lip20t/t/tell21b/b/big22h/h/hot23k/k/kite24v/v/valentine25w/w/wet26x/ks/fox27eeE double E, always says /E/see28th/th/ /TH/math, them29sh/sh/fish30ar/ar/far31ck/k/ 2-letter /k/stick32or/or/for33oo/oo/ /OO/pool, foot34wh/w/where35er/er/her36ir/er/first37ur/er/nurse38wor/wor/works39ear/er/early40ow/ow/ /O/cow, snow41ou/ow/ /O/ /oo/ /u/out, soul, you, touch42oa/O/boat43oe/O/toe44ay/A/ the two letter /A/ that we MAY use at the end of a wordplay45ai/A/ the two letter /A/ that we MAY Not use at the end of a wordsnailLevel K (Introducing 1-31)Level 1 (Introducing 32-43)Level 2 (Introducing 44-58)

©2025 Classical School Solutions9Readers In Rhyme46oy/oy/ that we MAY use at the end of a word.boy47oi/oy/ that we may NOT use at the end of a word.boil48ea/E/ /e/ /A/eat, bread, steak49aw/aw/ that we MAY use at the end of a wordsaw50au/aw/ that we may NOT use at the end of a wordsauce51ed/ed/ /d/ /t/melted, warmed, baked52ch/ch/ /k/ /sh/child, school, chef53ng/ng/song54tch/ch/ 3-letter chhatch55ui/oo/fruit56eigh/A/ four letter /A/weight57ey/A/ /E/ that we MAY use at the end of a wordthey, key58ei/A/ /E/ that we may NOT use at the end of a wordveil, ceiling59ie/E/ /I/cookie, pie60igh/I/ 3-letter /I/fight61ew/oo/ /U/ that we MAY use at the end of a word.new, few62eu/oo/ /U/ that we may NOT use at the end of a word.neutral, feud63dge/j/ 3-letter /j/badge64kn/n/ 2-letter /n/ used only at the beginning of a wordknee65gn/n/ 2-letter /n/ used both at the beginning and end of a word.gnat, sign66gu/g/ 2-letter /g/ guest67ph/f/ 2-letter /f/phone 68wr/r/ 2-letter /r/write69ough/O/ /oo/ /uff/ /off/ /aw/ /ow/ though, through, tough, cough, thought, bough70ti/sh/ tall letter /sh/ used at the beginning of a syllable after the first one.na-tion71si/sh/ /zh/ used at the beginning of a syllable after the first one.mis-sion vi-sion72ci/sh/ short letter /sh/ used at the beginning of a syllable after the first one.spe-cialLevel 3 (Introducing 59-72)

TEACHER’S NOTESLesson 1A, 1B, 1C, 1D©2025 Classical School Solutions10Phonograms we are working on this week: AY Nursery Rhyme: “Tom, Tom the Pipers Son” Popular English Nursery Rhyme Fickle FayRead Aloud Reader•Dry Erase Boards"•Letter Tiles"•Plastic Sheet Protectors"Readers In Rhyme Bluebonnet Set 41-50"• 41. Fickle Fay"Letter Tiles • Guide students to sound out their phonogram tiles to build words from the lesson. You can do this as a class (guided) to begin with and slowly move it to independent work. Dry Erase Board activities •Guide students to sound out and write words from each lesson onto their dry erase board. You can do this as a class (guided) to begin with and slowly move it to independent work. Plastic Sheet Protector activities •Use plastic sheet protectors to create dry erase sheets for students to copy words . You can place phonogram sheets from the lesson in the sheet protectors and let the student complete the work this way. Phonics Bingo •Play games of phonics bingo. Dictation-On a separate piece of lined paper •When dictating phonograms make sure to say all the sounds each phonogram makes. When dictating sentences say each word in the sentence slowly allowing students time to sound out and write the words. Once the students have written the complete sentence, say it again slowly allowing students to check their work. You can gradually increase the pace as the students are ready. Read Aloud •We recommend daily read aloud time.. Set aside 15-30 minutes per day for reading and discussion/narration.Materials•The Mouse and the Motorcycle Chapters 1-3 by Beverly ClearyConsult Reader Guides for helpful vocabulary and comprehension questions.

Lesson 1A©2025 Classical School Solutions11Read the sentences below. All phonograms have been underlined for you. The arrows remind you of the “silent e” words.1. Ben will stay and play at home all day.2. The foal makes his bed in the hay.3. The moose and the goose ran away on Sun-day.4. Do not stray on your way home from the play.Phonics PracticeReview Phonograms from Level 1 with the students each day.Daily Dictation: Phonograms of the day: O /o/ /O/ /oo/ /u/, OO /oo/ /OO/, OU /ow/ /O/ /oo/ /u/, OE /O/, Sentence of the day: Mom is mad at sad dot.d-aydayp-aypayh-ayhayc-l-ayclayp-l-ayplayt-r-aytrayRead to the student: This is the phonogram ay /A/ the two letter /A/ that we MAY use at the end of the word as in (HAY). First read each sound in the words below, then put them together to read the word. Phonogram ay

Lesson 1A©2025 Classical School Solutions12grayhaystaydaysaynayplayspraystaypayprayplaypayplaypraywaytracktrayHave the student read the words, circle the word that matches the picture and then write the word. Phonics Practice

Lesson 1A©2025 Classical School Solutions13 HandwritingTrace the letters and then write your own starting on the dot.Trace the numbers and then write your own starting on the dots.Trace the ay phonograms below. Draw water and waves and other sea creatures.

Lesson 1A©2025 Classical School Solutions14GrammarCapitalization and punctuation: Unscramble and rewrite the sentence correctly. Read to the student: unscramble the words below to make a sentence. Write the sentence on the lines below using correct capitalization and punctuation. Remember! Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a period (.)Parts of Speech: Verbs Read to the student: A verb shows action! For instance in the sentence “I ran to the park.” Ran is the verb because it tells what I did. A noun is a person, place or thing. Play the grammar game. Have your student complete the sentence below using the appropriate parts of speech and using the words below. in the tree I climbThe bighad to catsitbatflyNounsVerbsto eat.

Lesson 1B©2025 Classical School Solutions15Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms of the day: EAR /er/, WH /wh/, Y /y/ /i/ /I/ /E/, QU /kw/, ER /er/, OO /oo/ /OO/, Sentence of the day: Dan runs fast on the sand.r l s w pRead to the student: How many words can you make using the phonogram ay.awplgrprtrThe gray sheep likes to sleep all day.

Lesson 1B©2025 Classical School Solutions16haybowlboatroadcowsgirlfacetreesbarnfarmbirdscornplaytoesfeedlakeWrite an “ow” word.Choose words from the list that are found in the picture and write them below.Write an “oa” word.Write an “ay” word.Write a “silent e” word.Study the picture below with the student. Have the student read the list of words and and circle words that that are found in the picture.22Phonics Practice

Lesson 1B©2025 Classical School Solutions17PoetryOral Exercise — Tell which words rhyme at the end of each line. Underline all of the “ay” phonograms and the “ow” phonograms.Tom, Tom, the Piper’s SonTom, Tom, the piper’s son, Learned to play when he was young, But all the tune that he could play, Was “Over the hills and far away, Over the hills and a great way off, And the wind will blow my top-knot off.” Say the poem together daily and have the students learn by heart for recitation. Recitation Is recommended for the end of the week. Have the students recite the poem chorally and a few students can be selected to present the poem in a small group or individually.

Lesson 1B©2025 Classical School Solutions18HandwritingTrace the letters and then write your own starting on the dot.Trace the ay phonograms below. Trace the ay words below.complete the Blue Jay dot-to-dot.

Lesson 1B©2025 Classical School Solutions19GrammarWritten Exercise - Dictation: Have your student listen as you read “Tom, Tom The Piper’s Son”. Have them fill in the missing words from the options below. Gently have your student erase and correct any mistakes. Be sure to spell all the words correctly. Tom, Tom, the piper's son, Learned to when he was young, But all the that he could play, Was "Over the hills and far , Over the hills and a great off, And the wind will my top-knot off." wayplayblowtuneaway2

Lesson 1C©2025 Classical School Solutions20Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation:Phonograms of the day: OU /ow/ /O/ /oo/ /u, UR /er/, CK /k/ the 2 letter /k/, OW /ow/ /O//, ER /er/, WH /wh/, Sentence of the day: The early bird gets the worm.See how many words can you make with the phonogram “ay” using the letters in the boxes below. You may use the same letter more than once.\\ay\\ay\\ay\\ay\\ay\\ay\\ay\\aytldghprsThe cow likes to play by the stacks of hay.

Lesson 1C©2025 Classical School Solutions21Male birds do not \\\\\ eggs.pay lay\\\\\ I have a slice of cake?Complete the sentences phonograms ay.Have the student fill in the sentences below with the correct word. Have them read each sentence out loud as they write.Gray MayOur rabbit likes to sleep in \\\\. clay hayThere is a \\\\\ cat that likes to come into our yard.stray trayPhonics Practice

Lesson 1C©2025 Classical School Solutions22HandwritingTrace the letters and then write your own starting on the dot.Trace the ay phonograms below. Trace the sentence below.Draw bales of hay for the sheep and cow.

Lesson 1C©2025 Classical School Solutions23GrammarCapitalization and punctuation: Unscramble and rewrite the sentence correctly. Read to the student: unscramble the words below to make a sentence. Write the sentence on the lines below using correct capitalization and punctuation. Remember! Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a period (.)Parts of Speech: Verbs Read to the student: A verb shows action! For instance in the sentence “I ran to the park.” Ran is the verb because it tells what I did. A noun is a person, place or thing. Play the grammar game. Have your student complete the sentence below using the appropriate parts of speech and using the words below. on the mat sat cat theThe redis going tokitefloatBalloonflyNounsVerbsin the sky.

Lesson 1D©2025 Classical School Solutions24Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms of the day: OE /O/, OA /O/, WOR /wor/, OW /ow/ /O, AR /ar/, UR /er/, Sentence of the day: I did not want to rip my shirt.Read to the student: Using red and blue crayons, color the vowel pair phonograms red and all other phonograms blue. Use your phonogram tiles above to check your work. The first two have been completed for you as an example.Blue Jay needs a bit of hay for his nest.

Lesson 1D©2025 Classical School Solutions25haysaypaystaydayclaywayfraywaypraytrayswaybayawayplayRead to the student: Little Fay needs our help with the hay. Help Fay gather the hay into the barn by reading all of the “AY” words. As you read, use a red crayon to underline all of the “AY” phonograms in the words on the stacks of hay.Phonics Practice

Lesson 1D©2025 Classical School Solutions26 HandwritingTrace the letters and then write your own starting on the dot.Trace the ay phonograms below. Trace the sentence below. Trace the ay words below. Copy the hen in the box provided.

Lesson 1D©2025 Classical School Solutions27Picture StudyRead to the student: Let’s explore this picture. What is the little girl doing? Is this a quiet or a loud scene? Does the picture have more warm colors (yellow, orange, red) or more cool colors (blue, green, purple)? Study the girl’s face. See how it’s lighter on one side. The sun is hitting her face. Point to where you think the sunshine is coming from. What do you imagine the little girl’s name to be?

Lesson 1D©2025 Classical School Solutions28Grammarsad the dog isParts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Find three nouns in the picture study on the previous page. Draw or place a triangle on the nouns in the picture. Grammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounPCapitalization and punctuation: Unscramble and rewrite the sentence correctly. Read to the student: unscramble the words below to make a sentence. Write the sentence on the lines below using correct capitalization and punctuation. Remember! Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a period (.)

TEACHER’S NOTESLesson 2A, 2B, 2C, 2D©2025 Classical School Solutions30Phonograms we are working on this week: AI Nursery Rhyme: “Johnny Shall Have A New Bonnet” Popular Nursery Rhyme Daisy MayRead Aloud Reader•Dry Erase Boards"•Letter Tiles"•Plastic Sheet Protectors"Readers In Rhyme Bluebonnet Set 41-50"• 42. Daisy May"Letter Tiles • Guide students to sound out their phonogram tiles to build words from the lesson. You can do this as a class (guided) to begin with and slowly move it to independent work. Dry Erase Board activities •Guide students to sound out and write words from each lesson onto their dry erase board. You can do this as a class (guided) to begin with and slowly move it to independent work. Plastic Sheet Protector activities •Use plastic sheet protectors to create dry erase sheets for students to copy words . You can place phonogram sheets from the lesson in the sheet protectors and let the student complete the work this way. Phonics Bingo •Play games of phonics bingo. Dictation-On a separate piece of lined paper •When dictating phonograms make sure to say all the sounds each phonogram makes. When dictating sentences say each word in the sentence slowly allowing students time to sound out and write the words. Once the students have written the complete sentence, say it again slowly allowing students to check their work. You can gradually increase the pace as the students are ready. Read Aloud •We recommend daily read aloud time.. Set aside 15-30 minutes per day for reading and discussion/narration.Materials•The Mouse and the Motorcycle Chapters 4-6 by Beverly ClearyConsult Reader Guides for helpful vocabulary and comprehension questions.

Lesson 2A©2025 Classical School Solutions311. We will wait for the rain to stop.2. The cow likes to swish his tail in the air.3. Gail likes to braid her hair.4. I will fish with worms as bait. 5. I love to get corn dogs at the State Fair.Read the sentences below. All phonograms have been underlined for you. The arrows remind you of the “silent e” words.Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms of the day: OE /O/ QU /kw/, OR /or/, SH /sh/, ER /er/, WH /wh/, Sentence of the day: Run, run as fast as you can.s-n-ai-lsnailp-ai-lpailr-ai-nrainw-ai-twaitf-ai-lfailm-ai-lmailt-ai-ltailf-ai-rfairPhonogram aiRead to the student: This is the phonogram ai /A/ the two letter /A/ that we may NOT use at the end of a word. First read each sound in the words below, then put them together to read the word.

Lesson 2A©2025 Classical School Solutions32Have the student read the words, circle the word that matches the picture and then write the word. rakerailrainchainchasechairnamenailnaysnakesnaresnailpailpaidpaintradetraintrailPhonics Practice

Lesson 2A©2025 Classical School Solutions33HandwritingTrace the letters and then write your own starting on the dot.Trace the ai phonograms below.Complete the maze to help the snail get to the flower. Trace the ai words below.

Lesson 2A©2025 Classical School Solutions34GrammarCapitalization and punctuation: Unscramble and rewrite the sentence correctly. Read to the student: unscramble the words below to make a sentence. Write the sentence on the lines below using correct capitalization and punctuation. Remember! Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a period (.)Parts of Speech: Verbs Read to the student: A verb shows action! For instance in the sentence “I ran to the park.” Ran is the verb because it tells what I did. A noun is a person, place or thing. Play the grammar game. Have your student complete the sentence below using the appropriate parts of speech and using the words below. tea I likeThe tinyhad to dogmeowcatbarkNounsVerbsto eat.

Lesson 2B©2025 Classical School Solutions35Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms of the day: OW /ow/ /O/, TH /th/ /TH/, OE /O/, O /o/ /O/ /oo/ /u/, EAR /er/, OR /or/, Sentence of the day: The dish ran from the spoon.tr st n tr n w The snail likes to play with the flowers in the rain.Say to the student: Add the phonograms ay or ai to form words below. Remember, ay is the two letter /A/ that we MAY use at the end of a word and ai is the two letter /A/ that we MAY NOT use at the end of a word.br nl st gr n 

Lesson 2B©2025 Classical School Solutions36Write an “sh” word.Write an “ir” word.Write an “ee” word.Write a “ai” word.Study the picture below with the student. Have the student read the list of words and circle words that are found in the picture.Choose words from the list that are found in the picture and write them below.mothsnailtoesfairplayfeethairgirlshelltreesshirtdirtPhonics Practice

Lesson 2B©2025 Classical School Solutions37PoetryOral Exercise — The word “bonny” means pretty or nice. Underline all of the “ai” phonograms. Have your teacher or parent read the poem again and listen for the two “ai” phonograms in the poem that rhyme.Johnny Shall Have A New BonnetJohnny shall have a new bonnet, And Johnny shall go to the fair, And Johnny shall have a blue ribbon To tie up his bonny brown hair. Say the poem together daily and have the students learn by heart for recitation. Recitation Is recommended for the end of the week. Have the students recite the poem chorally and a few students can be selected to present the poem in a small group or individually.

Lesson 2B©2025 Classical School Solutions38 HandwritingTrace the letters and then write your own starting on the dot.Trace the ai phonograms below. Trace the ai sentence below. Draw the snail’s shell. Color the picture.

Lesson 2B©2025 Classical School Solutions39GrammarWritten Exercise - Dictation: Have your student listen as you read “Johnny Shall Have a New Bonnet”. Have them fill in the missing words from the options below. Gently have your student erase and correct any mistakes. Be sure to spell all the words correctly. Johnny have a new bonnet, And Johnny shall go to the , And Johnny shall have a ribbon To tie up his bonny . brownfairshallbluehair

Lesson 2C©2025 Classical School Solutions40AY “The /A/ that we MAY use at the end of a word as in hay.Daily Dictation: Dictate the following words to the student one at a time. Have student write each word in the proper column according to which phonogram that the word uses. Have the student underline the phonogram in each word. If the student is unsure, repeat the word saying “/A/ that we MAY use or /A/ that we MAY NOT use at the weed of a word. Remind the student that if they hear the /A/ at the end of a word it is AY. Words: day, gain, raid, play, stay, hair, gray, nail, fail, pray.AI “The /A/ that we MAY NOT use at the end of a word as in snail.Phonics PracticeHave the student point to the phonograms and say their sounds.

Lesson 2C©2025 Classical School Solutions41d sybr np ntm lbr dt lRead to the student: Use the phonogram ai to make words below. Underline the phonogram in each word. Write the words, sound out the words and then match each word with the correct picture.Phonics Practice

Lesson 2C©2025 Classical School Solutions42HandwritingTrace the letters and then write your own starting on the dot.Trace the ai phonograms below. Trace the numbers and then write your own starting on the dot.Color the raccoon in the rain below.

Lesson 2C©2025 Classical School Solutions43GrammarCapitalization and punctuation: Unscramble and rewrite the sentence correctly. Read to the student: unscramble the words below to make a sentence. Write the sentence on the lines below using correct capitalization and punctuation. Remember! Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a period (.)Parts of Speech: Verbs Read to the student: A verb shows action! For instance in the sentence “I ran to the park.” Ran is the verb because it tells what I did. A noun is a person, place or thing. Play the grammar game. Have your student complete the sentence below using the appropriate parts of speech and using the words below. Jump so far you didThe pinkis going toplanedrivecarfloatNounsVerbsacross the pond.

Lesson 2D©2025 Classical School Solutions44Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms of the day: OA /O/, OU /ow/ /O/ /oo/ /u/, EE “E double E always says /E/”, S /s/ /z/, IR /er/, WH /wh/, Sentence of the day: Look at the toad on the road.Read to the student: Using red and blue crayons, color the vowel pair phonograms red and all other phonograms blue. Use your phonogram tiles above to check your work. The first two have been completed for you as an example.Jay the snail went to mail a card to his pal Gail.

Lesson 2D©2025 Classical School Solutions45Read to the student: Leo is a big scaredy cat. He is scared of his own shadow. Can you read all of the ai words and help Leo get back home?rainpainpaidraidhairhairstairnailnailwaitplaingrainPhonics Practice

Lesson 2D©2025 Classical School Solutions46HandwritingTrace the letters and then write your own starting on the dot.Trace the ai phonograms below. Trace the ai words below. Complete the dot-to-dot and draw tracks for the train.

Lesson 2D©2025 Classical School Solutions47Picture StudyRead to the student: Let’s explore this picture. What is the little boy doing? Is this a quiet or a loud scene? Does the picture have more warm colors (yellow, orange, red) or more cool colors (blue, green, purple)? The mother sits and happily watches her student while she sews. Find a toy horse. Find and ark. Find a fire. Find a big green cushion. What do you think the little boy is writing about?

Lesson 2D©2025 Classical School Solutions48Grammarfar the ball I tossedParts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Find three nouns in the picture study on the previous page. Draw or place a triangle on the nouns in the picture. Grammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounPCapitalization and punctuation: Unscramble and rewrite the sentence correctly. Read to the student: unscramble the words below to make a sentence. Write the sentence on the lines below using correct capitalization and punctuation. Remember! Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a period (.)

TEACHER’S NOTESLesson 3A, 3B, 3C, 3D©2025 Classical School Solutions49Phonograms we are working on this week: OY Nursery Rhyme: “Boys and Girls Come out to Play” Popular Nursery Rhyme Ahoy RoyRead Aloud Reader•Dry Erase Boards"•Letter Tiles"•Plastic Sheet Protectors"Readers In Rhyme Bluebonnet Set 41-50"• 43. Ahoy Roy"Letter Tiles • Guide students to sound out their phonogram tiles to build words from the lesson. You can do this as a class (guided) to begin with and slowly move it to independent work. Dry Erase Board activities •Guide students to sound out and write words from each lesson onto their dry erase board. You can do this as a class (guided) to begin with and slowly move it to independent work. Plastic Sheet Protector activities •Use plastic sheet protectors to create dry erase sheets for students to copy words . You can place phonogram sheets from the lesson in the sheet protectors and let the student complete the work this way. Phonics Bingo •Play games of phonics bingo. Dictation-On a separate piece of lined paper •When dictating phonograms make sure to say all the sounds each phonogram makes. When dictating sentences say each word in the sentence slowly allowing students time to sound out and write the words. Once the students have written the complete sentence, say it again slowly allowing students to check their work. You can gradually increase the pace as the students are ready. Read Aloud •We recommend daily read aloud time.. Set aside 15-30 minutes per day for reading and discussion/narration.Materials•The Mouse and the Motorcycle Chapters 7-10 by Beverly ClearyConsult Reader Guides for helpful vocabulary and comprehension questions.

Lesson 3A©2025 Classical School Solutions501. The little boy likes to annoy me.2. Roy takes his toys to Grandma's house.3. I will enjoy a nap on this rainy day.4. Soon we will set sail on a voyage.5. Ahoy said the sailor on the boat. Read the sentences below. All phonograms have been underlined for you. The arrows remind you of the “silent e” words.2Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms of the day: IR /er/, CK /k/ the 2 letter /k/, AY /A/ the two letter /A/ that we MAY use at the end of the word, OE /O/, ER /er/, WH /wh/, Sentence of the day: How far did the ball go?t-oytoyb-oyboyj-oyjoya-h-oyahoyp-l-oyployRead to the student: The phonogram oy says /oy/ that we may use at the end of a word as in “toy”. First read each sound in the words below, then put them together to read the word. Phonogram oy

Lesson 3A©2025 Classical School Solutions51boyboldboatroadroyalrockoysteroverorbitcoldcowcowboytoptorntoyvergevotevoyageHave the student read the words, circle the word that matches the picture and then write the word. Phonics Practice

Lesson 3A©2025 Classical School Solutions52HandwritingTrace the letters and then write your own starting on the dot.Trace the oy phonograms below.Trace the sentence below. Complete the maze to help the boy find his toy.

Lesson 3A©2025 Classical School Solutions53GrammarCapitalization and punctuation: Unscramble and rewrite the sentence correctly. Read to the student: unscramble the words below to make a sentence. Write the sentence on the lines below using correct capitalization and punctuation. Remember! Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a period (.)Parts of Speech: Verbs Read to the student: A verb shows action! For instance in the sentence “I ran to the park.” Ran is the verb because it tells what I did. A noun is a person, place or thing. Play the grammar game. Have your student complete the sentence below using the appropriate parts of speech and using the words below. a kite I seeThe boytoysthrowsballplaysNounsVerbsto his dog.the

Lesson 3B©2025 Classical School Solutions54Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms of the day: AI /A/ the two letter /A/ that we may NOT use at the end of a word, QU /kw/, OW /ow/ /O/, OR /or/, UR /er/, WH /wh/, Sentence of the day: Clint pets his brown dog.pl  ster l al enj Say to the student: Add the phonograms oy to form words below.b t s r al c Fred Fox set sail on a voyage around the world.2

Lesson 3B©2025 Classical School Solutions55Write an “sh” word.Write an “ir” word.Write an “oy” word.Write a “silent E” word.Study the picture below with the student. Have the student read the list of words and circle words that are found in the picture.Choose words from the list that are found in the picture and write them below.mothertoystoesboysplayshorthairgirlhorsesmileshirtfacePhonics Practice

Lesson 3B©2025 Classical School Solutions56PoetryOral Exercise — The word “doth” is an old fashioned word that means do or does. Underline all of the “oy” and “ay” phonograms. Have your teacher or parent read the poem again and tell which words rhyme and then end of each line.Boys and Girls Come out to PlayBOYS and girls, come out to play; The moon doth shine as bright as day. Come with a whoop, come with a call, Come with a good will, or don’t you come at all! Up with the ladder and down the wall, A halfpenny roll will serve us all. You find milk and I’ll find flour, And we’ll have a pudding in less than an hour. Say the poem together daily and have the students learn by heart for recitation. Recitation Is recommended for the end of the week. Have the students recite the poem chorally and a few students can be selected to present the poem in a small group or individually.

Lesson 3B©2025 Classical School Solutions57HandwritingTrace the letters and then write your own starting on the dot.Trace the oy phonograms below.Trace the words below. Draw the crown on the Queen’s head.

Lesson 3B©2025 Classical School Solutions58 and girls, come out to play; The doth as bright as .  with a whoop, come with a call, Come with a will, or don't you come at all! GrammarWritten Exercise - Dictation: Have your student listen as you read “Girls and Boys Come Out to Play”. Have them fill in the missing words from the options below. Gently have your student erase and correct any mistakes. Be sure to spell all the words correctly. moondayshineBoysComegood

Lesson 3C©2025 Classical School Solutions59Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms of the day: OU /ow/ /O/ /oo/ /u/, OW /ow/ /O/, OO /oo/ /OO/, O /o/ /O/ /oo/ /u/, OE /O, WH /wh/, Sentence of the day: The tan van went beep, beep.See how many words can you make with the phonograms “ay” and “oy” using the letters in the boxes below. You may use the same letter more than once.\\ay\\ay\\ay\\ay\\oy\\oy\\oy\\oytbjprsTroy is a boy that likes to play the drums.

Lesson 3C©2025 Classical School Solutions60I hope you \\\\\\\\ your summer trip.We will find \\\\\\\\ at the shore.The Queen is in the \\\\\\\ family.Roy will \\\\\\\\ the wasp nest.enjoy destroyComplete the sentences phonograms oy.Have the student fill in the sentences below with the correct word. Have them read each sentence out loud as they write.loyal royaloysters enjoytoy enjoy3Phonics Practice

Lesson 3C©2025 Classical School Solutions61HandwritingTrace the letters and then write your own starting on the dot.Trace the oy phonograms below. Trace the numbers and then write your own starting on the dot.Draw the missing parts of the cat on the right.

Lesson 3C©2025 Classical School Solutions62GrammarCapitalization and punctuation: Unscramble and rewrite the sentence correctly. Read to the student: unscramble the words below to make a sentence. Write the sentence on the lines below using correct capitalization and punctuation. Remember! Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a period (.)Parts of Speech: Verbs Read to the student: A verb shows action! For instance in the sentence “I ran to the park.” Ran is the verb because it tells what I did. A noun is a person, place or thing. Play the grammar game. Have your student complete the sentence below using the appropriate parts of speech and using the words below. ran so far boy theTheis going toboyrowdogswimNounsVerbsin the lake.

Lesson 3D©2025 Classical School Solutions63Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms of the day: X /x/, AI /A/ the two letter /A/ that we may NOT use at the end of a word, OE /O/, EAR /er/, ER /er/, WH /wh/, Sentence of the day: I went to see the queen. Read to the student: Using red and blue crayons, color the vowel pair phonograms red and all other phonograms blue. Use your phonogram tiles above to check your work. The first two have been completed for you as an example.Ahoy said the boy from the deck of the boat.

Lesson 3D©2025 Classical School Solutions64joytoytoysahoyploycoyenjoydecoyoysterroyalboysoyloyalRead to the student: Roy needs your help to pick up his toys. Help Roy gather the toys into the toybox by reading all of the “OY” words. As you read, use a red crayon to underline all of the “OY” phonograms in the words on the toys.Phonics Practice

Lesson 3D©2025 Classical School Solutions65HandwritingTrace the letters and then write your own starting on the dot.Trace the oy phonograms below.Trace the words below. Color the picture.

Lesson 3D©2025 Classical School Solutions66Picture StudyRead to the student: Let’s explore this picture. What is the little boy doing? What toy is the boy playing on? What is the little girl holding? Are the children happy or sad? What do you think the children’s names are? How old do you think the boy is? How old do you think the girl is?

Lesson 3D©2025 Classical School Solutions67Grammara big boy is royParts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Find three nouns in the picture study on the previous page. Draw or place a triangle on the nouns in the picture. Grammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounPCapitalization and punctuation: Unscramble and rewrite the sentence correctly. Read to the student: unscramble the words below to make a sentence. Write the sentence on the lines below using correct capitalization and punctuation. Remember! Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a period (.)

TEACHER’S NOTESLesson 4A, 4B, 4C, 4D©2025 Classical School Solutions68Phonograms we are working on this week: OI Nursery Rhyme: “The Clock” Popular Nursery Rhyme Noisy PigsRead Aloud Reader•Dry Erase Boards"•Letter Tiles"•Plastic Sheet Protectors"Readers In Rhyme Bluebonnet Set 41-50"• 44. Noisy Pigs"Letter Tiles • Guide students to sound out their phonogram tiles to build words from the lesson. You can do this as a class (guided) to begin with and slowly move it to independent work. Dry Erase Board activities •Guide students to sound out and write words from each lesson onto their dry erase board. You can do this as a class (guided) to begin with and slowly move it to independent work. Plastic Sheet Protector activities •Use plastic sheet protectors to create dry erase sheets for students to copy words . You can place phonogram sheets from the lesson in the sheet protectors and let the student complete the work this way. Phonics Bingo •Play games of phonics bingo. Dictation-On a separate piece of lined paper •When dictating phonograms make sure to say all the sounds each phonogram makes. When dictating sentences say each word in the sentence slowly allowing students time to sound out and write the words. Once the students have written the complete sentence, say it again slowly allowing students to check their work. You can gradually increase the pace as the students are ready. Read Aloud •We recommend daily read aloud time.. Set aside 15-30 minutes per day for reading and discussion/narration.Materials•The Mouse and the Motorcycle Chapters 11-13 by Beverly ClearyConsult Reader Guides for helpful vocabulary and comprehension questions.

Lesson 4A©2025 Classical School Solutions69Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms of the day: AY /A/ the two letter /A/ that we MAY use at the end of the word, OU /ow/ /O/ /oo/ /u/, OW /ow/ /O/, U /u/ /U/ /OO/, TH /th/ /TH/, AR /ar/ Sentence of the day: The queen ate tarts.c-oi-ncoinc-oi-lcoils-oi-lsoiloi-n-koinkRead to the student: The phonogram oi says /oy/ that we MAY NOT use at the end of a word as in “coin”. First read each sound in the words below, then put them together to read the word. Phonogram oiRead the sentences below. All phonograms have been underlined for you. The arrows remind you of the “silent e” words.1. The pig oinks loudly until I take him his food.2. Mother says it is rude to point at others.3. My big brother will join the army soon.4. We will plant our crops in the soil.

Lesson 4A©2025 Classical School Solutions70boyboldboilconescotscoinsjokejoyjointpointpotpostpersonpoisonpointsoftsoilsoyHave the student read the words, circle the word that matches the picture and then write the word.Phonics Practice

Lesson 4A©2025 Classical School Solutions71HandwritingTrace the letters and then write your own starting on the dot.Trace the oi phonograms below.Complete the maze to help the pirate find the treasure. Trace the numbers and then write your own starting on the dot.

Lesson 4A©2025 Classical School Solutions72GrammarCapitalization and punctuation: Unscramble and rewrite the sentence correctly. Read to the student: unscramble the words below to make a sentence. Write the sentence on the lines below using correct capitalization and punctuation. Remember! Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a period (.)Parts of Speech: Verbs Read to the student: A verb shows action! For instance in the sentence “I ran to the park.” Ran is the verb because it tells what I did. A noun is a person, place or thing. Play the grammar game. Have your student complete the sentence below using the appropriate parts of speech and using the words below. jet was dog a bigBatswoodslivedeserthuntNounsVerbsfor food.in the

Lesson 4B©2025 Classical School Solutions73Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms of the day: OY /oy/ that we MAY use at the end of a word, QU /kw/, UR /er/, OA /O/, OR /or/, WH /wh/, Sentence of the day: The cat took a nap on my bed.j ntf l v d p nt Say to the student: Add the phonograms oi to form words below.b lt lp ntc n “Oink, oink” says Pete Pig as he plays in the mud.

Lesson 4B©2025 Classical School Solutions74tailgreencoatroadcowoinkfacetreeshousefarmtreestrailsoiltoesflow-ersraceChoose words from the list that are found in the picture and write them below.Study the picture below with the student. Have the student read the list of words and and circle words that that are found in the picture.2Write an “oa” word.Write an “ai” word.Write an “oi” word.Write a “silent e” word.2Phonics Practice

Lesson 4B©2025 Classical School Solutions75PoetryOral Exercise — What are the clocks hands? Underline all of the “oi” phonograms. Have your teacher or parent read the poem again and tell which words rhyme at then end of each line.The ClockThere's a neat little clock,— In the schoolroom it stands,— And it points to the time With its two little hands. And may we, like the clock, Keep a face clean and bright, With hands ever ready To do what is right. Say the poem together daily and have the students learn by heart for recitation. Recitation Is recommended for the end of the week. Have the students recite the poem chorally and a few students can be selected to present the poem in a small group or individually.

Lesson 4B©2025 Classical School Solutions76HandwritingTrace the letters and then write your own starting on the dot.Trace the oi phonograms below. Trace the oi words below. Draw coins in the piggy bank.

Lesson 4B©2025 Classical School Solutions77GrammarThere's a neat little ,— In the schoolroom it ,— And it to the time  its two little hands. And may we, like the clock, Keep a clean and bright, With hands ever ready  To do is right. Written Exercise - Dictation: Have your student listen as you read “The Clock”. Have them fill in the missing words from the options below. Gently have your student erase and correct any mistakes. Be sure to spell all the words correctly. pointsfaceclockWithstandswhat2

Lesson 4C©2025 Classical School Solutions78Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms of the day: TH /th/ /TH/, OR /or/, OE /O/, WOR /wor/, AY /A/ the two letter /A/ that we MAY use at the end of the word, SH /sh/, Sentence of the day: My dog needs a bath.Say to the student: Add the phonograms oy to form words below.oiloiloiloiloinoinointointctpfsjThe little boy makes lots of noise with his horn.

Lesson 4C©2025 Classical School Solutions79g\\tb\\tb\\lj\\ntc\\tf\\lPhonics PracticeRead to the student: Use the phonogram oa or oi to make words below. Write the words, read the words and then match each word with the correct picture.

Lesson 4C©2025 Classical School Solutions80HandwritingTrace the letters and then write your own starting on the dot.Trace the oi phonograms below. Trace the sentence below. Draw the roots of the tree underground. Draw an animal sitting in the tree.

Lesson 4C©2025 Classical School Solutions81GrammarCapitalization and punctuation: Unscramble and rewrite the sentence correctly. Read to the student: unscramble the words below to make a sentence. Write the sentence on the lines below using correct capitalization and punctuation. Remember! Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a period (.)Parts of Speech: Verbs Read to the student: A verb shows action! For instance in the sentence “I ran to the park.” Ran is the verb because it tells what I did. A noun is a person, place or thing. Play the grammar game. Have your student complete the sentence below using the appropriate parts of speech and using the words below. moo softly the cowsCatstheir longtailswagfurlickNounsVerbs.

Lesson 4D©2025 Classical School Solutions82Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms of the day: AI /A/ the two letter /A/ that we may NOT use at the end of a word OU /ow/ /O/ /oo/ /u//, OE /O/, CK /k/ the 2 letter /k/, TH /th/ /TH/, OA /O/, Sentence of the day: Go to the deep cave with me.Read to the student: Using red and blue crayons, color the vowel pair phonograms red and all other phonograms blue. Use your phonogram tiles above to check your work. The first two have been completed for you as an example.Troy and Joy will plant a wee tree in the soil.

Lesson 4D©2025 Classical School Solutions83coinmoistloinjoinjointfoilspoilpointhoistboiltoilboilbroilnoisevoiceoinkRead to the student: Save money by collecting coins into the piggy bank. Read all the words on the coins to collect them. As you read, use a red crayon to underline all of the “OI” phonograms in the words on the coins.Phonics Practice

Lesson 4D©2025 Classical School Solutions84HandwritingTrace the letters and then write your own starting on the dot.Trace the oi phonograms below. Trace the oi words below. Fill in the missing parts of the pictures to match the ones above.

Lesson 4D©2025 Classical School Solutions85Picture StudyRead to the student: Let’s explore this picture. What is the little girl doing? Is she being naughty or nice? What do you think will happen? The little girl is dying eggs. What holiday is she getting ready for? What do you think the girl’s name is? Find a Kangaroo. Find an ostrich. What do you think she calls the cat?

Lesson 4D©2025 Classical School Solutions86Grammara big boy is royParts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Find three nouns in the picture study on the previous page. Draw or place a triangle on the nouns in the picture. Grammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounPCapitalization and punctuation: Unscramble and rewrite the sentence correctly. Read to the student: unscramble the words below to make a sentence. Write the sentence on the lines below using correct capitalization and punctuation. Remember! Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a period (.)

TEACHER’S NOTESLesson 5A, 5B, 5C, 5D©2025 Classical School Solutions87Phonograms we are working on this week: EA Nursery Rhyme: “If All the World Was Apple Pie” Popular Nursery RhymeIce CreamRead Aloud Reader•Dry Erase Boards"•Letter Tiles"•Plastic Sheet Protectors"Readers In Rhyme Bluebonnet Set 41-50"• 45. Ice Cream"Letter Tiles • Guide students to sound out their phonogram tiles to build words from the lesson. You can do this as a class (guided) to begin with and slowly move it to independent work. Dry Erase Board activities •Guide students to sound out and write words from each lesson onto their dry erase board. You can do this as a class (guided) to begin with and slowly move it to independent work. Plastic Sheet Protector activities •Use plastic sheet protectors to create dry erase sheets for students to copy words . You can place phonogram sheets from the lesson in the sheet protectors and let the student complete the work this way. Phonics Bingo •Play games of phonics bingo. Dictation-On a separate piece of lined paper •When dictating phonograms make sure to say all the sounds each phonogram makes. When dictating sentences say each word in the sentence slowly allowing students time to sound out and write the words. Once the students have written the complete sentence, say it again slowly allowing students to check their work. You can gradually increase the pace as the students are ready. Read Aloud •We recommend daily read aloud time.. Set aside 15-30 minutes per day for reading and discussion/narration.Materials•The Children of Noisy Village Chapters 1-4 by Astrid LindgrenConsult Reader Guides for helpful vocabulary and comprehension questions.

Lesson 5A©2025 Classical School Solutions881. The ship will sail east on the sea.2. Josh will feast on peas and beans.3. I like to eat bread with butter and jam.4. Dad made the best steak on the grill today.23Read the sentences below. All phonograms have been underlined for you. The arrows remind you of the “silent e” words.Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms of the day: OA /O/, OY /oy/ that we MAY use at the end of a word, SH /sh/, OO /oo/ /OO/, WH /wh/, OU /ow/ /O/ /oo/ /u/ Sentence of the day: I will bake a cake for you.Read to the student: The phonogram ea has three different sounds. “E” (leaf), “e” (bread) and “A”(steak) For each of the words below, have the student read each sound, then put them together to read the word. Then have the student read the sentences. Phonogram eab-r-ea-kbreaks-w-ea-tsweath-ea-theats-t-ea-ksteakb-r-ea-dbreadl-ea-fleaf1 /E/2 /e/3 /A/

Lesson 5A©2025 Classical School Solutions89pailpearpaineareasteattealtailtearstealteateenbarnbestbearbeanbeardbraid2Phonics PracticeHave the student read the words, circle the word that matches the picture and then write the word.

Lesson 5A©2025 Classical School Solutions90HandwritingTrace the letters and then write your own starting on the dot.Trace the ea phonograms below.Complete the maze to help Dr. Bear find the mouse.Trace the numbers and then write your own starting on the dot.

Lesson 5A©2025 Classical School Solutions91GrammarCapitalization and punctuation: Unscramble and rewrite the sentence correctly. Read to the student: unscramble the words below to make a sentence. Write the sentence on the lines below using correct capitalization and punctuation. Remember! Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a period (.)Parts of Speech: Verbs Read to the student: A verb shows action! For instance in the sentence “I ran to the park.” Ran is the verb because it tells what I did. A noun is a person, place or thing. Play the grammar game. Have your student complete the sentence below using the appropriate parts of speech and using the words below. feast big a was it PigsmudeatscrapsplayNounsVerbsfor fun.in the

Lesson 5B©2025 Classical School Solutions92Phonics PracticeHave the student point to the phonograms and say their sounds.Dictation: Phonograms: OY /oy/ that we MAY use at the end of a word, AI /A/ the two letter /A/ that we may NOT use at the end of a word, OR /or/, WOR /wor/, OE /O/, WH /wh/, Sentence of the day: Do not be late for lunch.br d br k t m sw t b k h d b n l f 223321 /E/2 /e/3 /A/Read to the student: Add ea to from words below. Read the words out loud as you write them. The numbers help to remind you which sound of ea is on each word.111Ben Bear sits alone and eats his mint ice cream cone.

Lesson 5B©2025 Classical School Solutions93Write an “oo” word.Write an “ow” word.Write a 1st sound “ea” word.Choose words from the list that are found in the picture and write them below.Write a 2nd sound “ea” word.Study the picture below with the student. Have the student read the list of words and circle words that are found in the picture.foodbowltoesboweatshortbreadgirlseatspoonbearhead22222Phonics Practice

Lesson 5B©2025 Classical School Solutions94PoetryOral Exercise — What was the sea made of? What were the trees made of? Underline all of the “ea” phonograms. Have your teacher or parent read the poem again and tell which words rhyme at the end of each line.IF ALL THE WORLD WAS APPLE-PIE Say the poem together daily and have the students learn by heart for recitation. Recitation Is recommended for the end of the week. Have the students recite the poem chorally and a few students can be selected to present the poem in a small group or individually.If all the world was apple-pie And all the sea was ink, And all the trees were bread and cheese, What should we have to drink? It’s enough to make an old man Scratch his head and think

Lesson 5B©2025 Classical School Solutions953. HandwritingTrace the letters and then write your own starting on the dot.Trace the ea phonograms below. Trace the ea words below.Draw a branch or a rock for the eagle to sit on.

Lesson 5B©2025 Classical School Solutions96GrammarIf all the was apple-pie And all the was ink, And all the trees were and , should we have to drink? It's enough to make an old man Scratch his and thinkWritten Exercise - Dictation: Have your student listen as you read “If All the World Was Apple Pie”. Have them fill in the missing words from the options below. Gently have your student erase and correct any mistakes. Be sure to spell all the words correctly. headWhatcheeseworldbreadsea22

Lesson 5C©2025 Classical School Solutions97Phonics PracticeHave the student point to the phonograms and say their sounds.ea’s 1st sound /E/bread2leafea’s 2nd sound /E/leafbreaddeadseatbearmealheattreadeastheadDaily Dictation: Dictate the list of words to the student one at a time. Have the student write each word in the proper column according to the sound of “ea” that the word uses.22222

Lesson 5C©2025 Classical School Solutions98eatleafsealpeaseaglebreadRead to the student: Copy each word on the line below and underline the phonograms in the word. Match each word with the appropriate picture. Mark a “2” above words that make the second sound of “ea”.Phonics Practice

Lesson 5C©2025 Classical School Solutions99HandwritingTrace the letters and then write your own starting on the dot.Trace the ea phonograms below. Trace the ea words below. 2233Draw a forrest or cave for the bear.

Lesson 5C©2025 Classical School Solutions100GrammarCapitalization and punctuation: Unscramble and rewrite the sentence correctly. Read to the student: unscramble the words below to make a sentence. Write the sentence on the lines below using correct capitalization and punctuation. Remember! Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a period (.)Parts of Speech: Verbs Read to the student: A verb shows action! For instance in the sentence “I ran to the park.” Ran is the verb because it tells what I did. A noun is a person, place or thing. Play the grammar game. Have your student complete the sentence below using the appropriate parts of speech and using the words below. the grill dad steaks madeThe shipon the bigseasailswavessinksNounsVerbs.

Lesson 5D©2025 Classical School Solutions101Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms of the day: OO /oo/ /OO/, E /e/ /E/, AY /A/ the two letter /A/ that we MAY use at the end of the word, OA /O ER /er/, IR /er/, Sentence of the day: Mike rode his bike home.Read to the student: Using red and blue crayons, color the phonograms in the words below. Color the vowel pair phonograms red and all other phonograms blue. Use your phonogram tiles above to check your work. The first two have been completed for you as an example.Neal the seal roams the sea to find fish to eat.

Lesson 5D©2025 Classical School Solutions102creamdreamspeakwearclearbeadpearteameasycleanfearleaveseadeartea22Read to the student: Can you help Bea the bear get safely to the ground? Read all the ea words on the clouds to help Bea land safely. Gather a red crayon and underline all of the ea phonograms in the words.Phonics Practice

Lesson 5D©2025 Classical School Solutions103HandwritingTrace the letters and then write your own starting on the dot.Trace the ea phonograms below. Trace the sentence below. Add water and other things to the sea. Color the picture.

Lesson 5D©2025 Classical School Solutions104Picture StudyRead to the student: Let’s explore this picture. What are the children doing? Do you think it is windy or calm? Why do you think so? Find the sea. Find bunnies? Does this picture have more warm colors (Yellow, Orange, Red) or cool colors (Blue, Green, Purple) What do you think the girl’s name is? What do you think the boy’s name is?

Lesson 5D©2025 Classical School Solutions105ran to the park janParts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Find three nouns in the picture study on the previous page. Draw or place a triangle on the nouns in the picture. Grammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounPCapitalization and punctuation: Unscramble and rewrite the sentence correctly. Read to the student: unscramble the words below to make a sentence. Write the sentence on the lines below using correct capitalization and punctuation. Remember! Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a period (.)Grammar

TEACHER’S NOTESLesson 6A, 6B, 6C, 6D©2025 Classical School Solutions106Phonograms we are working on this week: AW Nursery Rhyme: “See-Saw Margery Daw” Popular Nursery Rhyme Paw PrintsRead Aloud Reader•Dry Erase Boards"•Letter Tiles"•Plastic Sheet Protectors"Readers In Rhyme Bluebonnet Set 41-50"• 46. Paw Prints"Letter Tiles • Guide students to sound out their phonogram tiles to build words from the lesson. You can do this as a class (guided) to begin with and slowly move it to independent work. Dry Erase Board activities •Guide students to sound out and write words from each lesson onto their dry erase board. You can do this as a class (guided) to begin with and slowly move it to independent work. Plastic Sheet Protector activities •Use plastic sheet protectors to create dry erase sheets for students to copy words . You can place phonogram sheets from the lesson in the sheet protectors and let the student complete the work this way. Phonics Bingo •Play games of phonics bingo. Dictation-On a separate piece of lined paper •When dictating phonograms make sure to say all the sounds each phonogram makes. When dictating sentences say each word in the sentence slowly allowing students time to sound out and write the words. Once the students have written the complete sentence, say it again slowly allowing students to check their work. You can gradually increase the pace as the students are ready. Read Aloud •We recommend daily read aloud time.. Set aside 15-30 minutes per day for reading and discussion/narration.Materials•The Children of Noisy Village Chapters 5-8 by Astrid LindgrenConsult Reader Guides for helpful vocabulary and comprehension questions.

Lesson 6A©2025 Classical School Solutions107Read the sentences below. All phonograms have been underlined for you. The arrows remind you of the “silent e” words.1. I was in awe when I saw the size of the cake.2. We saw a hawk trap a mouse in his claws.3. The baby likes to crawl all over the house.4. The deep snow will take a week to thaw.Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms of the day: OE /O/, AI /A/ the two letter /A/ that we may NOT use at the end of a word, OY /oy/ that we MAY use at the end of a word, WH /wh, OW /ow/ /O/, OE /O/, Sentence of the day: Jan ran up the sand dune.f-aw-nfawnp-awpawh-aw-khawkc-l-awclawRead to the student: The phonogram aw says “/aw/ that we may use at the end of a word” as in “paw”. First read each sound in the words below, then put them together to read the word. Phonogram aw

Lesson 6A©2025 Classical School Solutions108jeersjawsjestseatsavesawfawnfairfastheathowlhawkyuckyearyawnpeelpoutpawHave the student read the words, circle the word that matches the picture and then write the word.Phonics Practice

Lesson 6A©2025 Classical School Solutions109HandwritingTrace the letters and then write your own starting on the dot.Trace the aw phonograms below.Complete the maze to help the boy find the sunshine.Trace the numbers and then write your own starting on the dot.

Lesson 6A©2025 Classical School Solutions110GrammarSentence combining: Combine the following sentences and rewrite as one sentence. Parts of Speech Complete the following sentences using words below: Read to the student: fill in the chart with words from the sentences below:Jan rode the bike.The bike was red.NounsVerbs1. Birds fly.2. Dogs bark.

Lesson 6B©2025 Classical School Solutions111Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms: AI /A/ the two letter /A/ that we may NOT use at the end of a word, EA /E/ /e/ /A/, OI /oy/ that we may NOT use at the end of a word/, OR /or/, ER /er/, OW /ow/ /O/, Sentence of the day: I like to sit in the shade.Read to the student: Add the AW phonogram to make words below. Read the words out loud as you write them.f n dr cl l n d n str br l th Ti-gers have paws with claws and jaws full of sharp teeth.2

Lesson 6B©2025 Classical School Solutions112pushhoewindowpawstoesgrowfacetreeflowershirtpathcoatrowtailgreennoselawnwoodbricksears2Write an “ee” word.Choose words from the list that are found in the picture and write them below.Write an “ow” word.Write an “aw” word.Write a “silent e” word.2Phonics Practice

Lesson 6B©2025 Classical School Solutions113PoetryOral Exercise — How much shall Jenny have a day? Underline all of the “aw” phonograms. Have your teacher or parent read the poem again and tell which words rhyme at the end of each line.SEE-SAW MARGERY DAWSEE-SAW, Margery Daw, Jenny shall have a new master. She shall have but a penny a day, Because she can’t work any faster. Say the poem together daily and have the students learn by heart for recitation. Recitation Is recommended for the end of the week. Have the students recite the poem chorally and a few students can be selected to present the poem in a small group or individually.

Lesson 6B©2025 Classical School Solutions114HandwritingTrace the letters and then write your own starting on the dot.Trace the aw phonograms below.Trace the aw words below.Fill in the missing parts of the cat on the right.

Lesson 6B©2025 Classical School Solutions115GrammarSee- , Margery Daw,Jenny have a new master.She shall have but a penny a ,Because can't any faster.Written Exercise - Dictation: Have your student listen as you read “See-Saw Margery Daw”. Have them fill in the missing words from the options below. Gently have your student erase and correct any mistakes. Be sure to spell all the words correctly. shesawshallworkday

Lesson 6C©2025 Classical School Solutions116Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms: OW /ow/ /O/, EA /E/ /e/ /A, OY /oy/ that we MAY use at the end of a word, OE /O/, AI /A/ the two letter /A/ that we may NOT use at the end of a word, WH /wh/, Sentence of the day: I will eat a bowl of soup.Read to the student: See how many words can you make with the phonogram “aw” using the letters in the boxes below. You may use the letters more than once.rjscplMy cat has sharp claws at the end of her paws.aw aw aw aw awn awn awn awn f

Lesson 6C©2025 Classical School Solutions117crawlyawnpawsdrawfawnjawsRead to the student: Copy each word on the line below and underline the phonograms in the word. Match each word with the appropriate picture.Phonics Practice

Lesson 6C©2025 Classical School Solutions118HandwritingTrace the letters and then write your own starting on the dot.Trace the aw phonograms below.Trace and read the aw words below.Draw trees or grass and mountains for the fawn.

Lesson 6C©2025 Classical School Solutions119Grammar.Sentence combining: Combine the following sentences and rewrite as one sentence. Parts of Speech Complete the following sentences using words below: Read to the student: fill in the chart with words from the sentences below:I ate ice cream.It was green.NounsVerbs1. The cat sleeps.2. The rabbit jumps.

Lesson 6D©2025 Classical School Solutions120Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms of the day: OW /ow/ /O, OA /O/, AY /A/ the two letter /A/ that we MAY use at the end of the word, IR /er/, OU /ow/ /O/ /oo/ /u/, OW /ow/ /O/, Sentence of the day: Ben went to the game.mRead to the student: Using red and blue crayons, color the phonograms in the words below. Color the vowel pair phonograms red and all other phonograms blue. Use your phonogram tiles above to check your work. The first two have been completed for you as an example.Dawn and Dave like to work on jig-saw puzzles.

Lesson 6D©2025 Classical School Solutions121Read to the student: Derek the Deer has lost his friend Robby the Raccoon. Read all of the aw words on the trees to help Derek find his way through the forest to Robby.fawnclawpawsdawnflawbawlcrawllawnthawsawjawssawPhonics Practice

Lesson 6D©2025 Classical School Solutions122 HandwritingTrace the letters and then write your own starting on the dot.Trace the aw phonograms below.Trace the aw sentence below.Color the picture of Margery Daw.

Lesson 6D©2025 Classical School Solutions123Picture StudyRead to the student: Let’s explore this picture. What is the little girl doing? What is the cat playing with? What do you think the little girl is making? Look outside the window. What do you see? What season do you think it is? Why do you think so? Find paws. Find bows. Find Shoes. Find yarn. Find roses. What do you think the cat’s name is?

Lesson 6D©2025 Classical School Solutions124Grammarrabbit peter carrots ateParts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Find three nouns in the picture study on the previous page. Draw or place a triangle on the nouns in the picture. Grammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounPCapitalization and punctuation: Unscramble and rewrite the sentence correctly. Read to the student: unscramble the words below to make a sentence. Write the sentence on the lines below using correct capitalization and punctuation. Remember! Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a period (.)

TEACHER’S NOTESLesson 7A, 7B, 7C, 7D©2025 Classical School Solutions125Phonograms we are working on this week: AU Nursery Rhyme: “Sleep, Baby, Sleep” Popular Nursery RhymeMaude & ClaudeRead Aloud Reader•Dry Erase Boards"•Letter Tiles"•Plastic Sheet Protectors"Readers In Rhyme Bluebonnet Set 41-50"• 47. Maude and Claude"Letter Tiles • Guide students to sound out their phonogram tiles to build words from the lesson. You can do this as a class (guided) to begin with and slowly move it to independent work. Dry Erase Board activities •Guide students to sound out and write words from each lesson onto their dry erase board. You can do this as a class (guided) to begin with and slowly move it to independent work. Plastic Sheet Protector activities •Use plastic sheet protectors to create dry erase sheets for students to copy words . You can place phonogram sheets from the lesson in the sheet protectors and let the student complete the work this way. Phonics Bingo •Play games of phonics bingo. Dictation-On a separate piece of lined paper •When dictating phonograms make sure to say all the sounds each phonogram makes. When dictating sentences say each word in the sentence slowly allowing students time to sound out and write the words. Once the students have written the complete sentence, say it again slowly allowing students to check their work. You can gradually increase the pace as the students are ready. Read Aloud •We recommend daily read aloud time.. Set aside 15-30 minutes per day for reading and discussion/narration.Materials•The Children of Noisy Village Chapters 9-13 by Astrid LindgrenConsult Reader Guides for helpful vocabulary and comprehension questions.

Lesson 7A©2025 Classical School Solutions126Read the sentences below. All phonograms have been underlined for you. The arrows remind you of the “silent e” words.1. My aunt Laura will take me to the show.2. Grandma took me on a jaunt to the store.3. Stay away from the tiger or he will maul you.4. We can use an old cart and horse to haul the load.223Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms of the day: OW /ow/ /O/, AY /A/ the two letter /A/ that we MAY use at the end of the word, WOR /wor/, EA /E/ /e/ /A/, ER /er/, WH /wh/, Sentence of the day: The birds went splish, splash in the bath.au-t-oautof-au-l-tfaultau-n-taunts-au-c-esauceh-au-lhaulc-au-s-ecauseRead to the student: The phonogram au says /aw/ that we may NOT use at the end of a word as in “auto”. First read each sound in the words below, then put them together to read the word. Phonogram au

Lesson 7A©2025 Classical School Solutions127pursepausepleasehaulhaunthotauntauditautosaucesaltsoftfaultfallfaucetvatvestvaultHave the student read the words, circle the word that matches the picture and then write the word. Phonics Practice

Lesson 7A©2025 Classical School Solutions128Handwriting Trace the letters and then write your own starting on the dot. Trace the au phonograms below. Trace the au words below.Complete the maze.

Lesson 7A©2025 Classical School Solutions129GrammarSentence combining: Combine the following sentences and rewrite as one sentence. Parts of Speech Complete the following sentences using words below: Read to the student: fill in the chart with words from the sentences below:That is a race car.It is old.NounsVerbs1. The boy runs fast.2. The cat jumps.

Lesson 7B©2025 Classical School Solutions130Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms: G /g/ /j/, QU /kw/, A /a/ /A/ /ah/, O /o/ /O/ /oo/, ER /er/, WH /wh/, Sentence of the day: Jan will jump into the pool.h\\l fr\\dj\\nt \\ntv\\lt m\\lRead to the student: Add au to from words below. Read the words out loud as you write them.Tawny the Tiger will pause the music to talk to her mother.

Lesson 7B©2025 Classical School Solutions131laundrybrickscarfpawstoesgrowfacetreeflowershirtpathcoatskirtclothgreennoselawnwoodWrite an “ir” word.Choose words from the list that are found in the picture and write them below.Write an “aw” word.Write an “au” word.Write a “silent e” word.Study the picture below with the student. Have the student read the list of words and and circle words that that are found in the picture."Phonics Practice

Lesson 7B©2025 Classical School Solutions132PoetryOral Exercise — A “vale” is a valley. Have your teacher or parent read the poem again and tell which words rhyme at the end of each line.SLEEP, BABY, SLEEPSLEEP, baby, sleep, Our cottage vale is deep; The little lamb is on the green, With woolly fleece so soft and clean. Sleep, baby, sleep. Say the poem together daily and have the students learn by heart for recitation. Recitation Is recommended for the end of the week. Have the students recite the poem chorally and a few students can be selected to present the poem in a small group or individually.

Lesson 7B©2025 Classical School Solutions133Handwriting Trace the letters and then write your own starting on the dot. Trace the au phonograms below.Trace the au words below. Draw what you think the boy will haul in his wheelbarrow. Color the picture.

Lesson 7B©2025 Classical School Solutions134Grammar , baby, sleep, Our cottage vale is ; The little lamb is on the , With woolly so soft and . Sleep, baby, sleep. Written Exercise - Dictation: Have your student listen as you read “Sleep, Baby, Sleep”. Have them fill in the missing words from the options below. Gently have your student erase and correct any mistakes. Be sure to spell all the words correctly. greenSleepdeepcleanfleece

Lesson 7C©2025 Classical School Solutions135Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms of the day: OA /O/, AI /A/ the two letter /A/ that we may NOT use at the end of a word, IR /er/, OO /oo/ /OO/, AR /ar/, CK /k/ the 2 letter /k/, Sentence of the day: Did you wash your feet?Read to the student: Use the letters in the boxes to make words below. Write each word and then read it out loud. Explain the meaning of any words the student might not know.cmjhhp\\aul\\aunt\\ause\\ault\\aul\\aunt\\ause\\aultfv

Lesson 7C©2025 Classical School Solutions136dr Read to the student: Copy each word on the line below and underline the phonograms in the word. Match each word with the appropriate picture.s ce p h nt s v lt Phonics Practice

Lesson 7C©2025 Classical School Solutions137HandwritingTrace the letters and then write your own starting on the dot.Trace the numbers and then write your own starting on the dot. Trace the au phonograms below.Draw a scene around the lion. Color the picture.

Lesson 7C©2025 Classical School Solutions1383. GrammarSentence combining: Combine the following sentences and rewrite as one sentence. Parts of Speech Complete the following sentences using words below: Read to the student: fill in the chart with words from the sentences below:I want eggs.I also want bacon.NounsVerbs1. I drove to the park.2. The kite flies in the sky.

Lesson 7D©2025 Classical School Solutions139Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms of the day: AW /aw/ that we MAY use at the end of a word, OE /O/, OU /ow/ /O/ /oo/ /u/, EA /E/ /e/ /A/, AR /ar/, WH /wh/, Sentence of the day: The gray cat ran away.Read to the student: Using red and blue crayons, color the phonograms in the words below. Color the vowel pair phonograms red and all other phonograms blue. Use your phonogram tiles above to check your work. The first two have been completed for you as an example.Dawn hauls her laundry to the back-yard to let it air dry.3m

Lesson 7D©2025 Classical School Solutions140Read to the student: Aunt Betty Bear went on a jaunt in the forrest and lost Freddy Fox. Read all of the au words on the trees to help Aunt Betty find her way through the forest to Freddy.haulmaultautflaunthauntlaudfraudgauntsaucevaultjauntpausePhonics Practice

Lesson 7D©2025 Classical School Solutions141HandwritingTrace the letters and then write your own starting on the dot. Trace the au phonograms below. Trace the au words below.Complete the dot-to-dot

Lesson 7D©2025 Classical School Solutions142Picture StudyRead to the student: The picture shows a fairy godmother and a baby resting in a crib of flowers. What is the fairy doing? Is she happy or sad? what do you think she is saying to the baby? Find all the little fairies. Find the moon. Find a pair of wings.

Lesson 7D©2025 Classical School Solutions143Grammarpond fish swam the inParts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Find three nouns in the picture study on the previous page. Draw or place a triangle on the nouns in the picture. Grammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounPCapitalization and punctuation: Unscramble and rewrite the sentence correctly. Read to the student: unscramble the words below to make a sentence. Write the sentence on the lines below using correct capitalization and punctuation. Remember! Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a period (.)

TEACHER’S NOTESLesson 8A, 8B, 8C, 8D©2025 Classical School Solutions144Phonograms we are working on this week: ED Nursery Rhyme: “A-Tisket, A-Tasket” Popular Nursery Rhyme Bonny Saved BunnyRead Aloud Reader•Dry Erase Boards"•Letter Tiles"•Plastic Sheet Protectors"Readers In Rhyme Bluebonnet Set 41-50"• 48. Bonny saved Bunny"Letter Tiles • Guide students to sound out their phonogram tiles to build words from the lesson. You can do this as a class (guided) to begin with and slowly move it to independent work. Dry Erase Board activities •Guide students to sound out and write words from each lesson onto their dry erase board. You can do this as a class (guided) to begin with and slowly move it to independent work. Plastic Sheet Protector activities •Use plastic sheet protectors to create dry erase sheets for students to copy words . You can place phonogram sheets from the lesson in the sheet protectors and let the student complete the work this way. Phonics Bingo •Play games of phonics bingo. Dictation-On a separate piece of lined paper •When dictating phonograms make sure to say all the sounds each phonogram makes. When dictating sentences say each word in the sentence slowly allowing students time to sound out and write the words. Once the students have written the complete sentence, say it again slowly allowing students to check their work. You can gradually increase the pace as the students are ready. Read Aloud •We recommend daily read aloud time.. Set aside 15-30 minutes per day for reading and discussion/narration.Materials•The Children of Noisy Village Chapters 14-17 by Astrid LindgrenConsult Reader Guides for helpful vocabulary and comprehension questions.

Lesson 8A©2025 Classical School Solutions145Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms: AR /ar/, EA /E/ /e/ /A, AI /A/ the two letter /A/ that we may NOT use at the end of a word, OA /O/, OI /oy/ that we may NOT use at the end of a word, WH /wh/, Sentence of the day: Dan has a scar on his arm.p-l-a-n-t-edplantede-n-d-edendedm-e-l-t-edmeltedl-i-f-t-edliftedh-or-n-edhornedp-l-ay-edplayedp-u-ll-edpulledk-i-ll-edkilled22 2 2m-i-x-edmixedw-a-sh-edwashedp-a-s-s-edpasseda-s-k-edasked33 3 3Phonogram edRead to the student: We are going to practice words that end with ED. ED can have three possible sounds: /ed/, /d/, /t/ as in LANDED, PLAYED, and WISHED. First say the base word and then say the ending. Then put the two together.ed’s first sound is /ed/ as in:ed’s second sound is /d/ as in:ed’s third sound is /t/ as in:

Lesson 8A©2025 Classical School Solutions1461. We planted the flowers in the garden.2. My ice cream melted in the sun.3. I cut my leg on a jagged rock.4. We loaded the car for our trip to the farm. Read to the student: Read the sentences below with the first sound of ED /ed/. All phonograms have been underlined for you. The arrows remind you of the “silent e” words.Read to the student: Add ed to form words below with the first sound of ed /ed/. Underline the ed phonogram and then read the words out loud.plant\\\hand\\\land\\\part\\\round\\\load\\\heat\\\fund\\\act\\\boot\\\Phonics Practice

Lesson 8A©2025 Classical School Solutions147HandwritingTrace the letters and then write your own starting on the dot.Trace the ed phonograms below.Trace the ed words below.Complete the maze.

Lesson 8A©2025 Classical School Solutions148GrammarSentence combining: Combine the following sentences and rewrite as one sentence. Parts of Speech Complete the following sentences using words below: Read to the student: fill in the chart with words from the sentences below:Bert wore red pants.He wore a green vest.NounsVerbs1. A girl planted seeds.2. The ice melted.

Lesson 8B©2025 Classical School Solutions149Phonics PracticeHave the student point to the phonograms and say their sounds.Dictation: Phonograms: TH /th/ /TH/, CK /k/ the 2 letter /k/, OO /oo/ /OO/, OI /oy/ that we may NOT use at the end of a word, EA /E/ /e/ /A/, AY /A/ the two letter /A/ that we MAY use at the end of the word, Sentence of the day: The baby took a nap.Read to the student: Add ed to form words below with the SECOND sound of ed /d/. Underline the ed phonogram and write a “2” above the phonogram then read the words out loud.joy\\\sav\\\tun\\\mov\\\siz\\\tir\\\curv\\\clos\\\kill\\\bor\\\The pup was tired after he played all day in the yard.22ed2

Lesson 8B©2025 Classical School Solutions150endedaddedbattedcavedclosedcagedboxedbakedburpedtimedwiredtiredflippeddippedskippedaimedsavedbored2+3=5222222222333333Phonics PracticeHave the student read the words, circle the word that matches the picture and then write the word.

Lesson 8B©2025 Classical School Solutions151PoetryOral Exercise — Underline all of the ED words in the poem. What colors were the little girl’s basket? Who picked up the girl’s letter?A-TISKET, A-TASKETA-TISKET, A-tasket, A green and yellow basket, I wrote a letter to my love, And on the way I dropped it. I dropped it, I dropped it! A little boy picked it up And put it in his pocket, Pocket, pocket!Say the poem together daily and have the students learn by heart for recitation. Recitation Is recommended for the end of the week. Have the students recite the poem chorally and a few students can be selected to present the poem in a small group or individually.

Lesson 8B©2025 Classical School Solutions152HandwritingTrace the letters and then write your own starting on the dot.Trace the ed phonograms below. 3Trace the ed words below.Draw a scene around the bunny.

Lesson 8B©2025 Classical School Solutions153GrammarA-tisket, A-tasket,A green and basket, I wrote a letter to my , And on the way I it. I dropped it, I dropped it! A little boy it up And put it in his pocket, Pocket, pocket!Written Exercise - Dictation: Have your student listen as you read “A-Tisket, A-Tasket”. Have them fill in the missing words from the options below. Gently have your student erase and correct any mistakes. Be sure to spell all the words correctly. loveyellowpickeddropped2

Lesson 8C©2025 Classical School Solutions154Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms of the day: OE /O/, EA /E/ /e/ /A/, OI /oy/ that we may NOT use at the end of a word, EAR /er/, OA /O/, OR /or/ Sentence of the day: Ben will take the dog to the park.Read to the student: Add ed to form words below with the THIRD sound of ed /t/. Underline the ed phonogram and write a “3” above the phonogram then read the words out loud.jok\\\milk\\\mix\\\bak\\\mask\\\help\\\hook\\\gulp\\\wip\\\rac\\\ed32Matt mixed the batter to bake a cake for the party3

Lesson 8C©2025 Classical School Solutions155\\\\\\\\ed\\\\\\\\ed\\\\\\\\ed\\\\\\\\ed\\\\\\\\ed\\\\\\\\ed\\\\\\\\ed\\\\\\\\ed/ed/ /d/ /t/plantpasslandplaycookaimkillact/ed/ /d/ /t//ed/ /d/ /t//ed/ /d/ /t//ed/ /d/ /t//ed/ /d/ /t//ed/ /d/ /t//ed/ /d/ /t/Read to the student: Have the student read the words, circle the word that matches the picture and then write the word. Phonics Practice

Lesson 8C©2025 Classical School Solutions156HandwritingTrace the letters and then write your own starting on the dot.Trace the ed phonograms below. Trace the numbers and then write your own starting on the dot.Fill in the missing parts of the cow on the right. Color the picture.

Lesson 8C©2025 Classical School Solutions157GrammarSentence combining: Combine the following sentences and rewrite as one sentence. Parts of Speech Complete the following sentences using words below: Read to the student: fill in the chart with words from the sentences below:Gail ate the beets.Gail ate kale and leeks.NounsVerbs1. A man mixed the paint.2. The girl played in the garden.

Lesson 8D©2025 Classical School Solutions158Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms of the day: ED /ed/ /d/ /t/, AU /aw/ that we MAY use at the end of a word, OI /oy/ that we may NOT use at the end of a word, AY /A/ the two letter /A/ that we MAY use at the end of the word, ER /er/, WH /wh/, Sentence of the day: Tell the dog not to bark.Read to the student: Using red and blue crayons, color the phonograms in the words below. Color the vowel pair phonograms red and all other phonograms blue. Use your phonogram tiles above to check your work. The first two have been completed for you as an example.Beth cooked dinner for a large crowd.3

Lesson 8D©2025 Classical School Solutions159coastedtrickedsailedpokedmixedvotedliftednamedboxedcalledfailedbakeddunkedlinedkilled222222hiked3333333Read to the student: Piggy must sail through rough seas. Read all of the “ed” words to help Piggy through the waves. The numbers remind you of which sound of “ed” is used /ed/d/t/Phonics Practice

Lesson 8D©2025 Classical School Solutions160HandwritingTrace the letters and then write your own starting on the dot.Trace the ed phonograms below. Trace the ed words below.Draw a scene around the helicopter.

Lesson 8D©2025 Classical School Solutions161Picture StudyRead to the student: Let’s explore this picture. The picture shows a fairy serving food to the children. What are all of her little fairies doing? How many children are in the picture? Find a fairy cutting bread. Find a fairy rolling dough. Find a fairy stirring a bowl. Find a fairy with a little plate of cookies. What do you think the Queen fairy’s name is?

Lesson 8D©2025 Classical School Solutions162Grammarsea ship on A sailed theParts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Find three nouns in the picture study on the previous page. Draw or place a triangle on the nouns in the picture. Grammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounPCapitalization and punctuation: Unscramble and rewrite the sentence correctly. Read to the student: unscramble the words below to make a sentence. Write the sentence on the lines below using correct capitalization and punctuation. Remember! Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a period (.)

TEACHER’S NOTESLesson 9A, 9B, 9C, 9D©2025 Classical School Solutions163Phonograms we are working on this week: CH Nursery Rhyme: “Mary Had A Little Lamb” Popular Nursery Rhyme Chet ChickRead Aloud Reader•Dry Erase Boards"•Letter Tiles"•Plastic Sheet Protectors"Readers In Rhyme Bluebonnet Set 41-50"• 49. Chet Chick"Letter Tiles • Guide students to sound out their phonogram tiles to build words from the lesson. You can do this as a class (guided) to begin with and slowly move it to independent work. Dry Erase Board activities •Guide students to sound out and write words from each lesson onto their dry erase board. You can do this as a class (guided) to begin with and slowly move it to independent work. Plastic Sheet Protector activities •Use plastic sheet protectors to create dry erase sheets for students to copy words . You can place phonogram sheets from the lesson in the sheet protectors and let the student complete the work this way. Phonics Bingo •Play games of phonics bingo. Dictation-On a separate piece of lined paper •When dictating phonograms make sure to say all the sounds each phonogram makes. When dictating sentences say each word in the sentence slowly allowing students time to sound out and write the words. Once the students have written the complete sentence, say it again slowly allowing students to check their work. You can gradually increase the pace as the students are ready. Read Aloud •We recommend daily read aloud time.. Set aside 15-30 minutes per day for reading and discussion/narration.Materials•Mrs. Piggle Wiggle Chapters 1-4 by Betty MacDonaldConsult Reader Guides for helpful vocabulary and comprehension questions.

Lesson 9A©2025 Classical School Solutions164Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation:Phonograms: AI /A/ the two letter /A/ that we may NOT use at the end of a word, OY /oy/ that we MAY use at the end of a word, OR /or/, WH /wh, UR /er/, EA /E/ /e/ /A/ Sentence of the day: I saw a ship on the sea.ch-i-ckchickch-ai-nchainch-i-pchipb-ea-chbeachch-ar-mcharmm-u-chmuchPhonogram chRead to the student: The phonogram ch can make three different sounds /CH/, /K/, /SH/ as in "CHICK”, “SCHOOL” and “CHEF”. The most common sound of ch is /CH/ as in CHICK and is underlined once in the words below. First read each sound in the words, then put them together to read the word. 1. I chose to eat chips with my lunch today.2. The bird is perched on the branch.3. I hope I see an ostrich at the zoo.4. I ran to the porch to hide from the rain. 3Read to the student: Read the sentences below with the first sound of ED /ed/. All phonograms have been underlined for you. The arrows remind you of the “silent e” words.

Lesson 9A©2025 Classical School Solutions165pouchcouchcrunchcheekcheckchestchurchchimechurnteachtorchporchchipscheckschestsverycherryfairyPhonics PracticeHave the student read the words, circle the word that matches the picture and then write the word.

Lesson 9A©2025 Classical School Solutions166HandwritingTrace the letters and then write your own starting on the dot.Trace the ch phonograms below.Trace the numbers and then write your own starting on the dot. Complete the maze below.

Lesson 9A©2025 Classical School Solutions167GrammarSentence combining: Combine the following sentences and rewrite as one sentence. Parts of Speech Complete the following sentences using words below: Read to the student: fill in the chart with words from the sentences below:I made lunch.Lunch was tasty.NounsVerbs1. I went to the zoo.2. The snow falls and swirls.

Lesson 9B©2025 Classical School Solutions168Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms of the day: ED /ed/ /d/ /t/, AI /A/ the two letter /A/ that we may NOT use at the end of a word, IR /er/, OU /ow/ /O/ /oo/ /u/, OE /O/, WH /wh/, Sentence of the day: I found a big rock on the path.Read to the student: Add ch to form words below with the first sound of CH /ch/. Underline the ch phonogram and then read the words out loud.pea\\\\\\eekcoa\\\pun\\\tea\\\\\\airmar\\\\\\ildpor\\\\\\armChad Cheese works out to stay in shape.

Lesson 9B©2025 Classical School Solutions169Choose words from the list that are found in the picture and write them below.Write an “ee” word.Write a “ou” word.Write a “ch” word.househoundchickscheeksgreengirlpailwatchroofchasebootsplaydayfeedcoathairRead to the student: Study the picture below with the student. Have the student read the list of words and circle or checkmark words that that are found in the picture. Write an “ai” word.Phonics Practice

Lesson 9B©2025 Classical School Solutions170PoetryOral Exercise — Underline all of the CH phonograms in the poem. What color was the lamb’s wool? What made the children laugh? Have your parent or teacher read the poem again and repeat the first two lines.Mary Had A Little LambMARY had a little lamb, Its fleece was white as snow; And everywhere that Mary went, The lamb was sure to go. It followed her to school one day, Which was against the rule; It made the children laugh and play, To see a lamb in school. Say the poem together daily and have the students learn by heart for recitation. Recitation Is recommended for the end of the week. Have the students recite the poem chorally and a few students can be selected to present the poem in a small group or individually.

Lesson 9B©2025 Classical School Solutions171HandwritingTrace the letters and then write your own starting on the dot.Trace the ch phonograms below. Trace the words below. Fill in the missing parts of the peach on the right.

Lesson 9B©2025 Classical School Solutions172GrammarMary had a little ,Its was white as snow; And everywhere that Mary went,The lamb was sure to go. It followed her to one day,  was against the rule; It made the laugh and play, To see a lamb in school. Written Exercise - Dictation: Have your student listen as you read “Mary Had A Little Lamb”. Have them fill in the missing words from the options below. Gently have your student erase and correct any mistakes. Be sure to spell all the words correctly. schoolfleeceWhichchildrenlamb2

Lesson 9C©2025 Classical School Solutions173Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms of the day: EE “E double E always says /E, ED /ed/ /d/ /t, AU /aw/ that we MAY NOT use at the end of a word, OY /oy/ that we MAY use at the end of a word, ER /er/, CK /k/ the 2 letter /k/, Sentence of the day: I can jump and run in the yard.chinincharourisuipugopeaPolly Peach is ready for the sum-mer sea-son.22Read to the student: Add ch before or after the letters below to form words with the first sound of CH /ch/. Underline the ch phonogram and then read the words out loud. The first two have been completed as an example.

Lesson 9C©2025 Classical School Solutions174church-Dictation- Dictate the words from the list to the student. Have the student write the words in the columns corresponding to the phonogram sound. Have the student underline the ch phonogram in each word and write a “2” above the second sound of CH /k/. 21. church2. school3. ache4. ouch5. anchor6. inch7. cheese8. such9. echo10. chillschool2222Phonics Practice

Lesson 9C©2025 Classical School Solutions175HandwritingTrace the letters and then write your own starting on the dot.Trace the ch phonograms below.Trace the sentence below. Trace the lamb below. Color the picture.

Lesson 9C©2025 Classical School Solutions176GrammarSentence combining: Combine the following sentences and rewrite as one sentence. Parts of Speech Complete the following sentences using words below: Read to the student: fill in the chart with words from the sentences below:I eat peaches for lunch.The peaches are ripe.NounsVerbs1. The sun burns my skin.2. Joe ran and jumped.

Lesson 9D©2025 Classical School Solutions177Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms of the day: OO /oo/ /OO/, EA /E/ /e/ /A/, OY /oy/ that we MAY use at the end of a word, OW /ow/ /O/, OU /ow/ /O/ /oo/ /u/, WH /wh/, Sentence of the day: The sun will burn my face.Read to the student: Using red and blue crayons, color the phonograms in the words below. Color the vowel pair phonograms red and all other phonograms blue. Use your phonogram tiles above to check your work. The first two have been completed for you as an example.Patty packed a peach in her lunch box.3

Lesson 9D©2025 Classical School Solutions178chopchickcharmlunchchugbenchouchchowchairchinteachranchchatsuchRead to the student: Mrs. Harriet Hen has lost her chicks! Read all of the “ch” words to help Harriet gather her chicks into the barn. Read the words a second time and underline all of the phonograms in the words. Underline Vowel friend phonograms in RED and all other phonograms in BLUE. *Answer key at the back of your packet.Phonics Practice

Lesson 9D©2025 Classical School Solutions179HandwritingTrace the letters and then write your own starting on the dot.Trace the ch phonograms below. Trace the ch words below.Draw a scene around the chair.

Lesson 9D©2025 Classical School Solutions180Picture StudyRead to the student: Let’s explore this picture. What is the boy doing? Where do you think he is going? Does it seem windy or calm? Why do you think so? Find a castle. Find a rainbow colored bird. Find two fish. Find a mermaid. What do you think the boy’s name is?

Lesson 9D©2025 Classical School Solutions181Grammarapple a ripe fell redParts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Find three nouns in the picture study on the previous page. Draw or place a triangle on the nouns in the picture. Grammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounPCapitalization and punctuation: Unscramble and rewrite the sentence correctly. Read to the student: unscramble the words below to make a sentence. Write the sentence on the lines below using correct capitalization and punctuation. Remember! Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a period (.)

TEACHER’S NOTESLesson 10A, 10B, 10C, 10D©2025 Classical School Solutions182Phonograms we are working on this week: NG Nursery Rhyme: “Billy, Billy, Come and Play” Popular Nursery Rhyme Long Way HomeRead Aloud Reader•Dry Erase Boards"•Letter Tiles"•Plastic Sheet Protectors"Readers In Rhyme Bluebonnet Set 41-50"• 50. Long Way Home"Letter Tiles • Guide students to sound out their phonogram tiles to build words from the lesson. You can do this as a class (guided) to begin with and slowly move it to independent work. Dry Erase Board activities •Guide students to sound out and write words from each lesson onto their dry erase board. You can do this as a class (guided) to begin with and slowly move it to independent work. Plastic Sheet Protector activities •Use plastic sheet protectors to create dry erase sheets for students to copy words . You can place phonogram sheets from the lesson in the sheet protectors and let the student complete the work this way. Phonics Bingo •Play games of phonics bingo. Dictation-On a separate piece of lined paper •When dictating phonograms make sure to say all the sounds each phonogram makes. When dictating sentences say each word in the sentence slowly allowing students time to sound out and write the words. Once the students have written the complete sentence, say it again slowly allowing students to check their work. You can gradually increase the pace as the students are ready. Read Aloud •We recommend daily read aloud time.. Set aside 15-30 minutes per day for reading and discussion/narration.Materials•Mrs. Piggle Wiggle Chapters 5-8 by Betty MacDonaldConsult Reader Guides for helpful vocabulary and comprehension questions.

Lesson 10A©2025 Classical School Solutions1831. I like to sing in church on Sundays.2. I will help put the icing on the cake.3. The little boy flung his toys in a fit of rage.4. I helped Mom hang the clothes to dry.Read the sentences below. The phonograms and “Silent E” words have been marked for you. 3Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms of the day: OE /O/, ED /ed/ /d/ /t/, AW /aw/ that we MAY use at the end of a word, OU /ow/ /O/ /oo/ /u/, WOR /wor/, OR /or/ Sentence of the day: The duck swam back to land.h-a-nghangr-i-ngrings-o-ngsongth-i-ngthingPhonogram ngRead to the student: The phonogram ng says /ng/ as is in “sing” or “ring.” First read each sound in the words, then put them together to read the word.

Lesson 10A©2025 Classical School Solutions184ringkingsinglungsstungclungwingflingswingringwingstingwingflingsingringsingbringPhonics PracticeHave the student read the words, circle the word that matches the picture and then write the word.

Lesson 10A©2025 Classical School Solutions185HandwritingTrace the letters and then write your own starting on the dot.Trace the NG phonograms below.Trace the numbers and then write your own starting on the dot. Complete the maze below.

Lesson 10A©2025 Classical School Solutions186GrammarSentence combining: Combine the following sentences and rewrite as one sentence. Parts of Speech Complete the following sentences using words below: Read to the student: fill in the chart with words from the sentences below:Dad pulls the wagon. The wagon is red.NounsVerbs1. Jane walks her dog.2. The dog runs and jumps.

Lesson 10B©2025 Classical School Solutions187Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms of the day: IR /er/, AY /A/ the two letter /A/ that we MAY use at the end of the word, CH /ch/ /k/ /sh/, EA /E/ /e/ /A/, OI /oy/ that we may NOT use at the end of a word, AR /ar/, Sentence of the day: I jumped down the wet path.sti\\\you\\\goi\\\thi\\\flu\\\spri\\\twa\\\bri\\\sla\\\alo\\\The King gave the Queen a huge ruby ring.2Read to the student: Use the phonogram ng to make words below. Write the word and read the word out loud.

Lesson 10B©2025 Classical School Solutions188Choose words from the list that are found in the picture and write them below.Write an “ee” word.Write a “ch” word.Write a “ng” word.churchsongbowcheeksgreengirlsingsockswreathfaceboystairchor-usschoolcoathairWrite an “ai” word.Read to the student: Study the picture below with the student. Have the student read the list of words and circle or checkmark words that that are found in the picture. 222Phonics Practice

Lesson 10B©2025 Classical School Solutions189PoetryOral Exercise — “Make haste” means to hurry. Underline all of the NG phonograms in the poem. What were Sam and Betsy doing over the new-mown grass? Have your parent or teacher read the poem again and repeat the first two lines.Billy, Billy, Come and PlayBILLY, Billy, come and play, While the sun shines bright as day. Yes, my Polly, so I will, For I love to please you still. Billy, Billy, have you seen Sam and Betsy on the green? Yes, my Poll, I saw them pass, Skipping o’er the new-mown grass. Billy, Billy, come along, And I will sing a pretty song. Oh, then, Polly, I’ll make haste; Not one moment will I waste. Say the poem together daily and have the students learn by heart for recitation. Recitation Is recommended for the end of the week. Have the students recite the poem chorally and a few students can be selected to present the poem in a small group or individually.

Lesson 10B©2025 Classical School Solutions190HandwritingTrace the letters and then write your own starting on the dot.Trace the NG phonograms below. Trace the NG words below.Draw flowers in the pot. Color the picture.

Lesson 10B©2025 Classical School Solutions191GrammarBilly, Billy, have you Sam and Betsy on the green? Yes, my Poll, I saw them pass, Skipping o'er the new- grass. Billy, Billy, come , And I will a pretty . Oh, then, Polly, I'll make haste; Not one moment will I waste. Written Exercise - Dictation: Have your student listen as you read “Billy, Billy, Come and Play”. Have them fill in the missing words from the options below. Gently have your student erase and correct any mistakes. Be sure to spell all the words correctly. mownsongseenalongsing2

Lesson 10C©2025 Classical School Solutions192Phonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms of the day: OU /ow/ /O/ /oo/ /u/, AY /A/ the two letter /A/ that we MAY use at the end of the word, CH /ch/ /k/ /sh/, ED /ed/ /d/ /t/, ER /er/, EA /E/ /e/ /A/, Sentence of the day: Jack took a bath in the tub.\\ung\\ung\\ung\\ungRead to the student: Use the letters from the boxes to make words below.rstsld\\ing\\ing\\ing\\ing\\ang\\ang\\ong\\onghThe bird flapped his wings and started to sing.3

Lesson 10C©2025 Classical School Solutions193sink-Dictation- Read to the student: NK is a blend and not a phonogram because it says both of the letter sounds but said them together quickly. “NG” is a phonogram because N and G together make a new sound. Listen as your parent or teacher reads the NK blend and NG phonogram words and write them in the columns below according to their sound.21. sink2. sing3. chunk4. stink5. ring6. sting7. thing8. think9. spring10. rinksingPhonics Practice

Lesson 10C©2025 Classical School Solutions194HandwritingTrace the letters and then write your own starting on the dot.Trace the NG phonograms below.Trace the sentence below. What is the little girl singing? Color the picture.

The Readers In Rhyme full Level 2 program includes 20 comprehensive lessons spanning 390 pages, designed to engage young learners with content rooted in classical education principles. Level 2 also comes with 20 readers (Bluebonnet 41-50, Plum 51-60) to reinforce the concepts taught. For physical samples, please contact Rebecca Shivone at rebecca.shivone@classicalteachers.com