Return to flip book view

Message

Written by Elizabeth Leigh Scagel and Rebecca Shivone Smith Teacher Instructions by Megan Schmitt A special thanks to the classroom teachers, reading specialists, special education teachers and our children for their valuable input and contributions to the writing of this curriculum. Classical School Solutions©2023 Classical School Solutions|classicalschoolsolutions.com All rights reserved

This book belongs to:

IINTRODUCTION1HOW TO USE THIS GUIDE3READERS IN RHYME SCOPE AND SEQUENCE4PHONOGRAM LIST8LESSON 1: Review Beginning Blends. Reader Suggestion: 21 - Pam’s Pram•Teacher Notes Lesson 1A, 1B, 1C, 1D11•Nursery Rhyme: “To Market, To Market”18•Picture Study: A Child’s Garden-Jessie Wilcox Smith28LESSON 2: Review Beginning Blends-Sounds of Y. Reader Suggestion: 22- Clint and Flint•Teacher Notes Lesson 2A, 2B, 2C, 2D30•Nursery Rhyme: “Boys and Girls Come Out to Play”37•Picture Study: The Children Set Sail With Music-Willy Pogany47LESSON 3: Review-EE. Reader Suggestion: 23- See the Bees•Teacher Notes Lesson 3A, 3B, 3C, 3D49•Nursery Rhyme: “This Little Pig Went to Market”56•Picture Study: The Queen Bee-Ada Dennis66LESSON 4: Review-TH Reader Suggestion: 24- Seth and Cass•Teacher Notes Lesson 4A, 4B, 4C, 4D68•Nursery Rhyme: “Three Little Kittens”75•Picture Study: Jumping Jacks-Marjory C. Woodbury85LESSON 5: Silent E. Reader Suggestion: 25- Wake Up Jake•Teacher Notes Lesson 5A, 5B, 5C, 5D87•Nursery Rhyme: “Pat-A-Cake”94•Picture Study: Up, Up and Away-Joyce L. Brisley104LESSON 6: Phonogram SH. Reader Suggestion: 26- Shep and Shelly•Teacher Notes Lesson 6A, 6B, 6C, 6D106•Nursery Rhyme: “The Birdies Bath”113•Picture Study: Apple Picking Picnic-V. E . J e n k i n s123

IILESSON 7: Phonogram AR. Reader Suggestion: 27- Barb and Carl•Teacher Notes Lesson 7A, 7B, 7C, 7D125•Nursery Rhyme: “Twinkle Twinkle Little Star”132•Picture Study: What the Sun Looks Like When It’s Asleep-Willy Pogany142LESSON 8: Phonogram CK Reader Suggestion: 28- Lucky Duck•Teacher Notes Lesson 8A, 8B, 8C, 8D144•Nursery Rhyme: “Hickory Dickory Dock”151•Picture Study: The Farmer’s Boy-Randolph Caldecott 161LESSON 9: OR, Silent E #2 Reader Suggestion: 29- Hobby Horse•Teacher Notes Lesson 9A, 9B, 9C, 9D163•Nursery Rhyme: “Little Boy Blue”170•Picture Study: Ride to Banbury Cross-Joyce Mercer180LESSON 10: Phonogram OO Reader Suggestion: 30- By the Brook•Teacher Notes Lesson 10A, 10B, 10C, 10D182•Nursery Rhyme: “Hey Diddle-Diddle”189•Picture Study: Bookland Adventures199LESSON 11: Phonogram WH Reader Suggestion: 31-Whale Tale•Teacher Notes Lesson 11A, 11B, 11C, 11D201•Nursery Rhyme: “Ding, Dong Bell”208•Picture Study: Story Time218LESSON 12: Phonogram ER Reader Suggestion: 32- Little Lads•Teacher Notes Lesson 12A, 12B, 12C, 12D220•Nursery Rhyme: “Peter, Peter Pumpkin Eater”227•Picture Study: Old Woman in the Shoe-Jessie Willcox Smith237LESSON 13: Phonogram IR, Silent E #3 Reader Suggestion: 33-Sir Rook•Teacher Notes Lesson 13A, 13B, 13C, 13D239•Nursery Rhyme: “Once I saw a little Bird”246•Picture Study: Lady with bird and children-Ruth Mary Hallock256LESSON 14: Phonogram UR Reader Suggestion: 34-Turtle Dove•Teacher Notes Lesson 14A, 14B, 14C, 14D258•Nursery Rhyme: “Little girl with a curl”265•Picture Study: boys about to hit girls with snowballs-Jenny Nystrom275

IIILESSON 15: Phonograms WOR, EAR Reader Suggestion: 35- Pop Pine Cone•Teacher Notes Lesson 15A, 15B, 15C, 15D277•Nursery Rhyme: “The Man in the Moon”284•Picture Study: The Princess Helen Jacobs294LESSON 16: Sounds of ER Reader Suggestion: 36- Fern and Vern•Teacher Notes Lesson 16A, 16B, 16C, 16D296•Nursery Rhyme: “Little Miss Muffet”303•Picture Study: Birthday Party on the Stairs-Gertrude Alice Kay313LESSON 17: Phonogram OW Reader Suggestion: 37- Bow Wow•Teacher Notes Lesson 17A, 17B, 17C, 17D315•Nursery Rhyme: “Mary, Mary Quite Contrary”322•Picture Study: The Wind-Ruth Mary Hallock332LESSON 18: Phonogram OU Reader Suggestion: 38- Mouse House•Teacher Notes Lesson 18A, 18B, 18C, 18D334•Nursery Rhyme: "Old King Cole”341•Picture Study: The Duet-Dorothy Wheeler351LESSON 19: Phonogram OA Reader Suggestion: 39-All Afloat•Teacher Notes Lesson 19A, 19B, 19C, 19D353•Nursery Rhyme: “The Squirrel Went Out to Cut the Hay”360•Picture Study: Bad Billy-Albert Kaye370LESSON 20: Phonogram OE Reader Suggestion: 40-Little Joe’s Toe•Teacher Notes Lesson 20A, 20B, 20C, 20D372•Nursery Rhyme: “It Snows and it Blows”379•Picture Study: Water the Dog-Marjory C. Woodbury389Master Copies for Dictation 391

©2023 Classical School Solutions1Welcome to Readers in Rhyme Language Arts program Level 1. This program is designed to ensure that learning phonics is enjoyable and easy for both teacher and student. At CSS our goal is to create beautiful, rich curriculum that is comprehensive but never overwhelming. Key Features: Scripted Lessons: Our Language Arts curriculum features step-by-step scripted lessons. Each lesson provides clear instructions, guiding you through the material easily. Open-and-Go Format: Easy prep and lesson planning. Multi-Sensory Approach: Listen, see and do. Engaging more than one sense at a time helps students process and retain what they are learning. Saying the phonogram sounds while tracing or writing, building words with magnetic letters or tiles, dictation etc. are just a few examples of this. While this approach is great for all students, it is especially helpful for students that struggle with learning to read. Color-coded phonograms aid with teaching and learning phonics: By using different colors to represent specific phonetic patterns or sounds, students can easily identify and recognize the patterns in words. This visual aid improves decoding skills, and assists in spelling. Red phonograms indicate the letter or letter group makes a vowel sound. Blue phonograms indicate the letter or letter group make a consonant sound. IntroductionPhonological and Phonemic Awareness Exercises: Help with developing crucial pre-reading and pre-writing skills. These exercises focus on recognizing and manipulating sounds in spoken language. These exercises are essential for early literacy development as they lay the foundation for reading and writing. Students learn to distinguish between different sounds, blend sounds together to form words, segment words into individual sounds, and manipulate sounds to create new words. These auditory based skills are a vital foundation for phonics instruction. Reading Warm Up: Have your students point to each phonogram and say the sounds. Reading Warm Up: Have your students point to each phonogram and say the sounds.

©2023 Classical School Solutions2Medial Sounds Say to the student: I’m going to say three words. Two of them will have the same MIDDLE sound. One of them will have a different middle sound. I want you to tell me which one is not like the others. Here is an example: beg, hit, met Beg and met both have the /e/ in the middle. Hit has an /i/ in the middle. Hit is not like the others. (It may be necessary to sound out the words slowly annunciating the vowel sound.)-Auditory Exercise-•hot, hat, mop •nap, slam, box •dig, top, dog •rod, sat, sock •bad, cup, map •mom, log, pinMastery Based Program: Our curriculum follows a carefully designed sequence, covering all essential phonics skills progressively. Each lesson builds upon the previous lesson and includes plenty of review. At Classical School Solutions, we strive to offer the best from the past in art and story. Our Readers In Rhyme feature beautiful vintage illustrations carefully restored alongside newly written stories. We hope the timeless themes of virtue in every day life inspire and delight your student. We are here to support you in any way we can. If you have questions, please feel free to contact us at info@classicalschoolsolutions.com. Or visit our website classicalschoolsolutions.com Happy reading! Example of auditory exercise found throughout this guide

31. Orient yourself to the flow of the pages and sequence of the activities. •Each lesson’s material is meant to be covered in one week. Each lesson is broken down into four days of teaching material in lessons A, B, C, and D. Day five of the school week is for review. Each daily lesson has activities that include phonics review and handwriting. •The nursery rhyme should be read to the children daily and they can work on memorizing each nursery rhyme. •Phonics exercises can be done in various ways and ideas for activities can be found in teachers notes at the beginning of each lesson. 2. The teacher’s guide is scripted for your conversation with the students. • The phonics lesson in total should only last 15-20 minutes. Follow up work with letter tiles, chalkboard, whiteboard, etc will reinforce the concepts taught. 3. Initially, work slowly to orient the children to the material. • The goal of this program is to give children a solid phonics foundation. It is much easier to work steadily on mastery than it is to remediate skills later on that were not learned in these early years. Some students will catch on quickly and may need an option for independent work. 4. Incorporating Movement • Try to incorporate movement to as much of the sound and letter recognition as you are able. Tracing the letter into the air as you say the sound is an easy activity they are able to do standing up. When the students practice handwriting have them say the sound(s) the phonogram makes while writing. 5. Repetition is Key • Do try to keep the same routine with the material. For those that are struggling this is very comforting. Practice makes progress!How To Use This Guide

Readers In Rhyme-Level KScope and Sequence©2023 Classical School Solutions4GOLDENROD SET - Books 1-101Hot DotCVC+Short O vowels2Fat CatCVC+Short A vowels3Big PigCVC+Short I vowels4Run SunCVC+Short U vowels, Third sound of O5Peg EggCVC+Short E vowels, Double Consonant GG6Top DogCVC+Short O vowels7Bad TadCVC+Short A vowels, Third sound of O8Will the PillCVC+Short I vowels, Second & Third sound of O, Second sound of E9Fun CubCVC+Short U vowels, Second & Third sound of O, Second sound of E10Wet PetCVC+Short E vowels, Second & Third sound of O, Second sound of E, Double Consonant SS11Clap for ClemCVC+Sounds of Vowels+Beginning Blends BL, BR, CL, CR, Double SS, LL12Fred FretsCVC+Sounds of Vowels+Beginning Blends DR, TR, FL, FR, Double SS, NN, LL13Glad GlenCVC+Sounds of Vowels+Beginning Blends GL, GR, PL, PR, Double SS, LL14Snug as a BugCVC+Sounds of Vowels+Beginning Blends SC, SK, SL, SN, Double SS, LL15Stop Don SopCVC+Sounds of Vowels+Sounds of Y+Beginning Blends SP, ST, SW, TW, Double SS, FF, LL16Hank’s PrankCVC+Sounds of Vowels+Beginning Blends+Ending Blends ND, NK, Double SS, LL17Romp & StompCVC+Sounds of Vowels+Sounds of Y+Beginning Blends+Ending Blends NT, FT, MP, LP, Double SS, NN, LL18Dust We MustCVC+Sounds of Vowels+Sounds of Y+Beginning Blends+Ending Blends ST, SK, LK, Double LL19Hog WildCVC+Sounds of Vowels+Beginning Blends+Ending Blends LD, LT, Double FF, LL20Plum BunsCVC+Sounds of Vowels+Sounds of Y+Review Beginning and Ending Blends, Double FFAPRICOT SET - Books 11-20

Readers In Rhyme-Level 1Scope and Sequence©2023 Classical School Solutions5TEAL SET - Books 21-3021Pam’s PramCVC+Sounds of Vowels+Review Beginning and Ending Blends22Clint and FlintCVC+Sounds of Vowels+Review Beginning and Ending Blends23See the BeesIntroducing Phonograms QU, EE24Seth and CassIntroducing Phonogram TH, Review Phonograms QU, EE25Wake Up JakeIntroducing Silent E, Review Phonograms QU, EE, TH26Shep & ShellyIntroducing Phonogram SH, Review Silent E, Review QU, EE, TH27Barb and CarlIntroducing Phonogram AR, Review “Silent E”, SH, QU, EE, TH28Lucky DuckIntroducing Phonogram CK, Review AR, “Silent E”, SH, QU, EE, TH29Hobby HorseIntroducing Phonogram OR, Review CK, AR, “Silent E”, SH, QU, EE, TH30By the BrookIntroducing Phonogram OO, Review OR, CK, AR, “Silent E”, SH, QU, EE, TH31Whale TaleIntroducing WH, Review OO, OR, CK, AR, “Silent E”, SH, QU, EE, TH32Little LadsIntroducing ER, Review QU, EE, TH, Silent E, SH, AR, CK, OR, OO33Sir RookIntroducing IR, Review QU, EE, TH, Silent E, SH, AR, CK, OR, OO, WH, ER34Turtle DoveIntroducing UR, Review EE, TH, Silent E, SH, AR, OR, OO, WH, ER, IR35Pop Pine ConeIntroducing WOR, EAR, Review QU, EE, TH, Silent E, AR, CK, OR, OO, WH, ER, IR36Fern and VernReview QU, EE, TH, SH, Silent E, AR, CK, OR, OO, WH, ER, IR, UR, WOR, EAR37Bow WowIntroducing OW, Review QU, EE, TH, SH, Silent E, AR, CK, OR, OO, WH, ER, IR, UR, WOR, EAR38Mouse HouseIntroducing OU, Review EE, TH, SH, Silent E, AR, CK, OR, OO, WH, ER, IR, WOR, EAR, OW39All AfloatIntroducing OA, Review EE, TH, SH, Silent E, AR, CK, OR, WH, IR, UR, WOR, OW, OU40Little Joe’s ToeIntroducing OE, Review EE, TH, SH, Silent E, AR, CK, OR, WH, IR, UR, WOR, OW, OUOLIVE SET - Books 31-40

Readers In Rhyme-Level 2Scope and Sequence©2023 Classical School Solutions6BLUEBONNET - Books 41-5041Fickle FayIntroducing AY, Review QU, EE, TH, SH, Silent E, AR, CK, OR, OO, WH, ER, IR, WOR, OW, OU, OA42Daisy MayIntroducing AI, Review QU, EE, TH, SH, Silent E, AR, CK, OR, OO, WH, ER, IR, OW, OU, OA, AY43Ahoy RoyIntroducing OY, Review QU, EE, TH, SH, Silent E, AR, CK, OR, OO, WH, ER, IR, OW, OU, OA, AY, AI44Noisy PigsIntroducing OI, Review QU, EE, TH, SH, Silent E, AR, CK, OR, OO, WH, ER, WOR, OW, OU, OA, AY, AI45Ice CreamIntroducing EA, (EE, TH, SH, Silent E, AR, CK, OR, OO, WH, ER, IR, UR, WOR, EAR, OW, OU, OA, AY, OY)46Paw PrintsIntroducing AW, (QU, EE, TH, SH, Silent E, AR, CK, OR, OO, WH, ER, IR, OU, OA, AY, AI, EA)47Maude & ClaudeIntroducing AU, (QU, EE, TH, SH, Silent E, AR, CK, OR, OO, WH, ER, EAR, OW, OU, OA, AY, AI, OY, EA)48Bonny Saved BunnyIntroducing ED, (QU, EE, TH, SH, Silent E, AR, CK, OR, OO, WH, ER, IR, UR, EAR, OW, OU, AY, AI, EA)49Chet ChickIntroducing CH, (QU, EE, TH, SH, AR, CK, OR, OO, WH, ER, IR, UR, WOR, OW, OU, OA, AY, AI, EA, ED)50Long Way HomeIntroducing NG, (EE, TH, SH, Silent E, AR, OO, WH, UR, WOR, OW, OU, OA, OE, AY, OI, EA, CH)51CrosspatchIntroducing TCH, (QU, EE, TH, SH, AR, CK, OR, OO, WH, ER, UR, EAR, OW, OU, OA, AY, EA, NG)52Betty JuneReview EE, TH, SH, AR, CK, OR, OO, WH, ER, IR, EAR, OW, OU, OE, AY, AI, OY, EA, AW, ED, CH, NG, TCH53On the RocksReview QU, EE, TH, SH, AR, CK, OR, OO, WH, UR, OW, OU, OA, OE, AY, EA, ED, CH, NG54Vain Mary JaneReview EE, TH, SH, AR, OR, OO, WH, UR, OW, OU, OA, OE, AY, EA, ED, CH, NG55Wee GoldfinchReview EE, TH, SH, AR, CK, OR, OO, WH, ER, OW, OU, OA, OE, AY, OI, EA, AW, CH, NG56Wild ChildReview EE, TH, SH, AR, CK, OR, OO, WH, ER, IR, EAR, OW, OU, OA, AY, AI, EA, NG, TCH57Fruity FolkReview EE, TH, SH, AR, OR, ER, OW, OU, OA, AY, AI, EA, AW, ED, CH, NG, UI58Little Red HenIntroducing EIGH, Review EE, TH, SH, CK, OO, WH, ER, WOR, OW, OU, AY, EA, ED, NG, TCH59Donkey DukeIntroducing EY, Review EE, TH, AR, CK, OO, WH, ER, UR, OW, AY, AI, NG60Gingerbread BoyIntroducing EI, Review TH, Silent E, SH, CK, ER, UR, OU, AY, AI, OY, EA, ED, TCHPLUM SET - Books 51-60

Readers In Rhyme-Level 3Scope and Sequence©2023 Classical School Solutions7SILVER SET - Books 61-7061Piggie WiggieIntroducing IE, (EE, TH, SH, AR, OR, OO, WH, ER, OW, OU, AI, EA, AW, ED, CH, NG)62OutfoxedIntroducing IGH, (QU, EE, TH, SH, AR, CK, OR, OO, WH, ER, WOR, OW, OU, AY, AI, OI, EA, AW, NG, TCH, IE)63Three KittensIntroducing EW, (EE, TH, SH, AR, OO, WH, ER, UR, OW, OU, OI, EA, ED, CH, NG, TCH, EY, EI, IE, IGH)64Billy Goats GruffIntroducing DGE, (EE, TH, SH, AR, OO, IR, OU, OA, AY, OI, EA, AW, ED, NG, EY, EI, IGH)65Lion & MouseIntroducing KN, GN, (QU, EE, TH, SH, AR, CK, OR, OO, WH, ER, UR, EAR, OU, OA, AY, AI, EA, AW, ED, CH, NG, EY, IE, IGH, EW)66Chicken LittleIntroducing GU, (QU, TH, SH, AR, CK, OR, OO, WH, ER, UR, EAR, OW, OU, AY, AI, OI, EA, AW, ED, CH, NG, EY, KN)67Wee RabbitIntroducing WR, (QU, EE, TH, SH, CK, OR, OO, WH, ER, EAR, OW, OU, OE, AY, AI, OI, EA, AW, ED, CH, NG, IGH, EW)68Mother GooseIntroducing OUGH, (EE, TH, SH, AR, CK, OR, OO, WH, ER, EAR, OW, OU, AY, AI, OI, EA, AW, ED, CH, NG, EY, IE, IGH, EW, KN)69Home at LastIntroducing TI, (EE, TH, SH, AR, CK, OR, OO, WH, ER, IR, OW, OU, OA, AY, EA, AW, ED, CH, NG, EY, EI, IE, KN, GN, WR, OUGH)70Flee the BeeIntroducing SI, (EE, TH, SH, AR, OR, OO, ER, UR, OW, OU, OA, OE, AY, AI, OY, EA, AW, AU, ED, NG, TCH, EY, IE, EW)71Robin & WrenIntroducing CI, (QU, EE, TH, SH, AR, CK, OR, WH, ER, IR, OW, OU, AY, AI, OY, EA, AW, ED, CH, NG, TCH, IE, IGH, EW, KN, WR, OUGH)72Brown HenQU, EE, TH, SH, AR, CK, OR, OO, WH, ER, OW, OU, OA, AY, EA, AW, AU, ED, CH, NG, EY, EI, KN, OUGH73Mouse TaleEE, TH, SH, AR, CK, OR, OO, WH, ER, WOR, OW, OU, OE, AY, AI, EA, ED, CH, IE, OUGH74GoldenhairEE, TH, SH, AR, CK, OR, OO, WH, ER, IR, OW, OU, AY, AI, EA, AW, ED, CH, NG, EY, EI, IE, IGH, DGE, OUGH75Chicken ScratchEE, TH, SH, AR, CK, OR, OO, ER, OW, OU, OA, AY, OI, EA, AW, ED, CH, NG, TCH, IE, IGH, EW76Clever PigEE, TH, AR, CK, OO, ER, OW, OU, AY, AI, OI, EA, AW, EY, IE, EW77BluebirdEE, TH, SH, AR, OR, OO, WH, ER, IR, UR, WOR, EAR, OW, OU, AY, AI, EA, AW, AU, ED, NG, TCH, EY, IE, IGH, EW, DGE, KN, OUGH78Jack-o-LanternQU, EE, TH, SH, AR, CK, OR, OO, WH, ER, EAR, OW, OU, AY, AI, OY, EA, AW, ED, CH, NG, EY, EI, IE, IGH, GU, OUGH79Little Girl BlueQU, EE, TH, SH, AR, CK, OR, OO, WH, IR, WOR, EAR, OW, OU, AY, AI, EA, AW, ED, CH, NG, TCH, EY, EI, IE, IGH, KN, OUGH80Stars in the SkyEE, TH, SH, AR, CK, OR, OO, WH, ER, UR, OW, OU, OA, AY, AI, EA, AW, ED, CH, NG, EY, IE, IGH, EW, KN, OUGHCHERRY SET - Books 71-80

©2023 Classical School Solutions8Readers In Rhyme72 Phonograms1c/k/ /s/cat, city2o/o/ /O/ /oo/u/not, no, too, love3g/g/ /j/go, gem4d/d/did5a/a/ /A/ /ah/bat, base, ball6s/s/ /z/sit, is7f/f/fun8qu/kw/quit9i/i/ /I/ /E/it, ice, me10r/r/run11n/n/no12m/m/mat13u/u/ /U/ /OO/up, cute, put14y/y/ /i/ /I/ /E/yes, gym, my, baby 15j/j/jump16p/p/pet17e/e/ /E/met, me18z/z/zoo19l/l/lip20t/t/tell21b/b/big22h/h/hot23k/k/kite24v/v/valentine25w/w/wet26x/ks/fox27eeE double E, always says /E/see28th/th/ /TH/math, them29sh/sh/fish30ar/ar/far31ck/k/ 2-letter /k/stick32or/or/for33oo/oo/ /OO/pool, foot34wh/w/where35er/er/her36ir/er/first37ur/er/nurse38wor/wor/works39ear/er/early40ow/ow/ /O/cow, snow41ou/ow/ /O/ /oo/ /u/out, soul, you, touch42oa/O/boat43oe/O/toe44ay/A/ the two letter /A/ that we MAY use at the end of a wordplay45ai/A/ the two letter /A/ that we MAY Not use at the end of a wordsnailLevel K (Introducing 1-31)Level 1 (Introducing 32-43)Level 2 (Introducing 44-58)

©2023 Classical School Solutions9Readers In Rhyme46oy/oy/ that we MAY use at the end of a word.boy47oi/oy/ that we may NOT use at the end of a word.boil48ea/E/ /e/ /A/eat, bread, steak49aw/aw/ that we MAY use at the end of a wordsaw50au/aw/ that we may NOT use at the end of a wordsauce51ed/ed/ /d/ /t/melted, warmed, baked52ch/ch/ /k/ /sh/child, school, chef53ng/ng/song54tch/ch/ 3-letter chhatch55ui/oo/fruit56eigh/A/ four letter /A/weight57ey/A/ /E/ that we MAY use at the end of a wordthey, key58ei/A/ /E/ that we may NOT use at the end of a wordveil, ceiling59ie/E/ /I/cookie, pie60igh/I/ 3-letter /I/fight61ew/oo/ /U/ that we MAY use at the end of a word.new, few62eu/oo/ /U/ that we may NOT use at the end of a word.neutral, feud63dge/j/ 3-letter /j/badge64kn/n/ 2-letter /n/ used only at the beginning of a wordknee65gn/n/ 2-letter /n/ used both at the beginning and end of a word.gnat, sign66gu/g/ 2-letter /g/ guest67ph/f/ 2-letter /f/phone 68wr/r/ 2-letter /r/write69ough/O/ /oo/ /uff/ /off/ /aw/ /ow/ though, through, tough, cough, thought, bough70ti/sh/ tall letter /sh/ used at the beginning of a syllable after the first one.na-tion71si/sh/ /zh/ used at the beginning of a syllable after the first one.mis-sion vi-sion72ci/sh/ short letter /sh/ used at the beginning of a syllable after the first one.spe-cialLevel 3 (Introducing 59-72)

TEACHER’S NOTESLesson 1A, 1B, 1C, 1D©2023 Classical School Solutions10Phonograms we are working on this week: Review blends and double consonants Handwriting: Clock Letters Nursery Rhyme: “To Market, To Market” Popular English Nursery Rhyme Pam’s Pram Reader•Dry Erase Boards"•Letter Tiles"•Plastic Sheet Protectors"Readers In Rhyme Teal Set 21-30"• 21. Pam’s Pram"Letter Tiles • Guide students to sound out their phonogram tiles to build words from the lesson. You can do this as a class (guided) to begin with and slowly move it to independent work. Dry Erase Board activities •Guide students to sound out and write words from each lesson onto their dry erase board. You can do this as a class (guided) to begin with and slowly move it to independent work. Plastic Sheet Protector activities •Use plastic sheet protectors to create dry erase sheets for students to copy words . You can place phonogram sheets from the lesson in the sheet protectors and let the student complete the work this way. Phonics Bingo •Play games of phonics bingo. Dictation-On a separate piece of lined paper •When dictating phonograms make sure to say all the sounds each phonogram makes. When dictating sentences say each word in the sentence slowly allowing students time to sound out and write the words. Once the students have written the complete sentence, say it again slowly allowing students to check their work. You can gradually increase the pace as the students are ready. Read Aloud •We recommend daily read aloud time. Set aside 15-30 minutes per day for reading and discussion/narration.Materials•The Velveteen Rabbit by William NicholsonRead AloudConsult Reader Guides for helpful vocabulary and comprehension questions.

Lesson 1A©2023 Classical School Solutions11Phonics PracticeReview Phonograms 1-31 from Level K with the students each day.Daily Dictation: Phonograms of the day: G /g/ /j/, QU /kw/, A /a/ /A/ /ah/, O /o/ /O/ /oo/ /u/ Sentence of the day: See the cat Pat.Auditory Exercise—Blending Say to the student: I’m going to say four sounds. I want you to put the sounds together to say a word. Each time you say a sound, put one finger up. Then say the sounds together. The sounds are /b/, /l/, /o/, /b/.•/t/+/r/+/a/+/p/ = trap •/p/+/r/+/e/+/p/ = prep •/s/+/t/+/e/+/m/ = stem •/p/+/l/+/o/+/p/ = plop •/t/+/r/+/i/+/p/ = tripReading Warm Up: Have your child point to each phonogram and say the sounds. /b/Reading Warm Up: Have your child point to each phonogram and say the sounds. /l/Reading Warm Up: Have your child point to each phonogram and say the sounds. /o/= blobReading Warm Up: Have your child point to each phonogram and say the sounds. Sight Word Practice: Point to each word above and have the child say the sight word. 2/b/b-e-ll b-i-ll d-o-llf-e-ll f-i-ll h-i-llg-i-ll p-i-ll s-e-llRead to the student: Today we will learn about words that end in LL. You only say the one sound for the letters. Practice the double LL words below.

Lesson 1A©2023 Classical School Solutions12Phonics PracticeRead to the student: Practice reading the sentences below. Nell has a bell.b-e-ll b-i-ll d-o-llf-e-ll f-i-ll h-i-llg-i-ll p-i-ll s-e-llMoll has a doll.22Read to the student: Trace and fill in the missing letters below. Sound out the word as you write. Read to the student: Rewrite the word bell below but change the /b/ to a /f/. Then read your new word.Read to the student: Rewrite the word doll below but change the /o/ to an /u/. Then read your new word.Read to the student: Rewrite the word hill below but change the /h/ to a /p/. Then read your new word.

Lesson 1A©2023 Classical School Solutions13 HandwritingTrace the numbers and then write your own starting on the dot. Clock Letterscogdasf Read to the student: Today we will practice some of the clock stroke letters. The clock stroke letters begin at 2 O’clock and go around the clock. Trace the letters below and then write your own starting on the dot. Remember to practice the sounds as you write. Observation: Can you spot the ten differences between the pictures?

Lesson 1A©2023 Classical School Solutions14Parts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Read the following words aloud to your student and have them draw or place a black triangle above all the nouns. Example: i ran to hug jan. IJGrammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounNoun VerbPersonalNounNoun VerbPersonalNounPPPCapitalization and punctuation: Correct the sentence below: Read to the student: Capitalize the first letter of the first word of every sentence. Capitalize someone’s name. Place a period (.) at the end of a sentence. bill can hop to bob hill box fell doll

Lesson 1B©2023 Classical School Solutions15Auditory Exercise—Phoneme Deletion Say to the student: I’m going to say a word. Then I’m going to ask you to take away part of the word and tell me what is left. For Example: If I say “flip”, now take away the /f/ what is left? “flip” take away /f/, is lip. “Lip” is the answer.•crib - /c/ = (rib) •drip - /d/ = (rip) •flap - /f/ = (lap) •drip - /d/ = (rip) •grim - /g/ = (rim)Phonics PracticeReview Beginning Blends Read to the student: Now we will review more blends. Blends are two or more consonants that each say their own sound but say them very close together. Point to the first word below and have the student practice saying the blend after you. Make sure they say the sounds the letters make together and not the letter names.p-l-a-nplanp-l-u-mplump-l-o-pplopp-l-o-tplotp-l-u-splusp-l-u-gplugp-r-a-mpramp-r-e-pprepp-r-i-mprimp-r-o-mpromp-r-o-dprodp-r-o-pprops-c-a-bscabs-c-a-mscams-c-a-nscans-c-a-tscats-c-u-dscuds-c-u-mscums-k-i-dskids-k-i-mskims-k-i-nskins-k-i-pskips-k-i-tskits-k-u-llskulls-c-a-bscabs-c-a-mscams-c-a-nscans-c-a-tscats-c-u-dscuds-c-u-mscums-k-i-dskids-k-i-mskims-k-i-nskins-k-i-pskips-k-i-tskits-k-u-llskullReview Phonograms 1-31 from Level K with the students each day.Dictation: Phonograms: EE “E double E always says /E/”, U /u/ /U/ /OO/, H /h/, TH /th/ /TH/, Sentence of the day: It is not a cat!

Lesson 1B©2023 Classical School Solutions16Phonics PracticedeskdropdollslamskinslipstunspillskullskunksipskipsniffslapsnapsnipslipsniffHave the student read the words, circle the word that matches the picture and then write the

Lesson 1B©2023 Classical School Solutions17To market, to market, to buy a fat pig; Home again, home again, jiggety-jig. To market, to market, to buy a fat hog; Home again, home again, jiggety-jog. To market, to market, to buy a plum bun; Home again, home again, market is done. To Market, To MarketOral Exercise — What animal did the boy buy at the market? What sweet thing did he buy? listen again and tell which words at the end of each line rhyme? Have the students memorize the poem over the the week.Say the poem daily and have the students learn by heart for recitation. Recitation Is recommended for the end of the week. Have the students recite the poem chorally and a few students can be selected to present the poem in a small group or individually.Nursery Rhyme

Lesson 1B©2023 Classical School Solutions18Clock LetterscogdasfClock Letterscogdasf Clock Letterscogdasf Read to the student: Today we will practice some of the clock stroke letters. The clock stroke letters begin at 2 O’clock and go around the clock. Trace the letters below and then write your own starting on the dot. Remember to practice the sounds as you write. C- /k/ /s/, O- /o/ /O/ /oo/, G- /g/ /j/Handwriting

Lesson 1B©2023 Classical School Solutions19Parts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Read the following words aloud to your student and have them draw or place a black triangle above all the nouns. Example: i ran to hug jan. IJGrammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounNoun VerbPersonalNounNoun VerbPersonalNounPPPCapitalization and punctuation: Correct the sentence below: Read to the student: Capitalize the first letter of the first word of every sentence. Capitalize someone’s name. Place a period (.) at the end of a sentence. prim has pet cats skipcatmatbell

Lesson 1C©2023 Classical School Solutions20Auditory Exercise—Alphabet Alliteration Say to the student: I’m going to say a silly sentence. It is an alliteration. That means that most of the words will start with the same sound. I want you to listen to the words and then tell me what sound most of the words start with. Example: Silly Sammy steals seals. Silly, Sammy, steals and seals all start with /s/.•Tiny toys took tacos Tuesday. •Fairy folk find funny foxes. •Nice ninjas name nosy neighbors. •Slimy slugs smell stinky swamps. •Puppies pick pizza piñatas .Read to the student: Review words that end in FF. You only say the one sound for the letters. Practice the double FF words below.o-ff b-u-ff c-u-ffh-u-ff j-i-ff m-u-ffp-u-ff g-u-ff t-i-ffPhonics PracticeReview Phonograms 1-31 from Level K with the students each day.Daily Dictation: Phonograms of the day: G /g/ /j/, QU /kw/, A /a/ /A/ /ah/, O /o/ /O/ /oo/ /u/ Sentence of the day: See the cat Pat.

Lesson 1C©2023 Classical School Solutions21Nell has a hat.Nell has a hat and a muff.Nell has a muff.Read to the student: Practice reading the sentences below. 222Read to the student: Trace and fill in the missing letters below. Sound out the word as you write. Read to the student: Rewrite the word nap below but change the /n/ to an /l/. Then read your new word.Read to the student: Rewrite the word off below but change the two ff’s to an /n/. Then read your new word.Read to the student: Rewrite the word sniff below but change the /n/ to a /k/. Then read your new word.Phonics Practice

Lesson 1C©2023 Classical School Solutions22 Clock Letterscogdasf Read to the student: Today we will practice more clock stroke letters. The clock stroke letters begin at 2 O’clock and go around the clock. Trace the letters below and then write your own starting on the dot. Remember to practice the sounds as you write. D- /d/, A- /a/ /A/ /ah/, S- /s/ /z/ F- /f/Draw a log for the frog to sit on. Add anything else to complete the scene. Color the picture.Handwriting

Lesson 1C©2023 Classical School Solutions23Parts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Read the following words aloud to your student and have them draw or place a black triangle above all the nouns. Example: i ran to hug jan. IJGrammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounNoun VerbPersonalNounNoun VerbPersonalNounPPPCapitalization and punctuation: Correct the sentence below: Read to the student: Capitalize the first letter of the first word of every sentence. Capitalize someone’s name. Place a period (.) at the end of a sentence. mom is mad at sad dot MomsadsnipDad

Lesson 1D©2023 Classical School Solutions24Phonics PracticeAuditory Exercise—Phoneme Deletion Say to the student: I’m going to say a word. Then I’m going to ask you to take away part of the word and tell me what is left. For Example: If I say “hand”, now take away the /h/ what is left? “hand” take away /h/, is and. “and” is the answer.•tale - /t/ = (ale) •tart - /t/ = (art) •feel - /f/ = (eel) •sore - /s/ = (ore) •mist- /m/ = (ist)Read to the student: Read the words below. Using a red crayon, color the vowels in the words below. The first word has been completed for you as an example.f-l-e-xflexf-l-a-pflapf-l-i-pflipf-l-a-gflagf-l-e-dfledf-l-a-tflatf-r-a-pfrapf-r-a-gfragf-r-o-gfrogf-r-e-tfretReview Phonograms 1-31 from Level K with the students each day.Daily Dictation: Phonograms of the day: G /g/ /j/, QU /kw/, A /a/ /A/ /ah/, O /o/ /O/ /oo/ /u/ Sentence of the day: It is a skunk!

Lesson 1D©2023 Classical School Solutions25Read to the student: Rewrite the word plum below but change the /m/ to a /s/. Then read your new word.Read to the student: Rewrite the word plus below but change the /s/ to an /m/. Then read your new word.Read to the student: Rewrite the word plug below but leave out the /l/. Then read your new word.Phonics PracticeReview Blends p+lRead to the child: Now we will work on more blends. Blends are two or more consonants that each say their own sound but say them very close together. Point to the first word below with the p+l blend and have the child practice saying the blend after you. Make sure they say the sounds the letters make together and not the letter names.p-l-a-nplanp-l-u-mplump-l-o-pplopp-l-o-tplotp-l-u-splusp-l-u-gplugp-r-a-mpramp-r-e-pprepp-r-i-mprimp-r-o-mpromp-r-o-dprodp-r-o-pprop

Lesson 1D©2023 Classical School Solutions26 MidlineShort Line Letters Read to the student: Today we will practice short line letters. The short line letters begin at the midline and go down to the baseline. Trace the letters below and then write your own starting on the dot. Remember to practice the sounds as you write. I- /i/ /I/ /E/, R- /r/, MidlineShort Line Letters MidlineShort Line Letters Trace the short line strokes to give the goat grass to eat. Add anything else to complete the scene. Color the picture.Handwriting

Lesson 1D©2023 Classical School Solutions27Picture StudyRead to the child: Let’s explore this picture. What are the children doing? Are they happy or sad? Who do you think the woman in the picture is? How many children are in the picture? Point to the child wearing a hat. Find an animal in the picture. Point to someone wearing a belt. Point to someone wearing a hat. What do you think the children’s names are?

Lesson 1D©2023 Classical School Solutions28Parts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Read the following words aloud to your student and have them draw or place a black triangle above all the nouns. Example: i ran to hug jan. IJGrammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounNoun VerbPersonalNounNoun VerbPersonalNounPPPCapitalization and punctuation: Correct the sentence below: Read to the student: Capitalize the first letter of the first word of every sentence. Capitalize someone’s name. Place a period (.) at the end of a sentence. cam and sam sit in the pram. pramfussstopPam

TEACHER’S NOTESLesson 2A, 2B, 2C, 2D©2023 Classical School Solutions30Phonograms we are working on this week: Handwriting: Clock Letters Nursery Rhyme: “Baa, Baa, Black Sheep” Popular English Nursery Rhyme Clint and Flint Reader•Dry Erase Boards"•Letter Tiles"•Plastic Sheet Protectors"Readers In Rhyme Teal Set 21-30"• 22. Clint and Flint"Letter Tiles • Guide students to sound out their phonogram tiles to build words from the lesson. You can do this as a class (guided) to begin with and slowly move it to independent work. Dry Erase Board activities •Guide students to sound out and write words from each lesson onto their dry erase board. You can do this as a class (guided) to begin with and slowly move it to independent work. Plastic Sheet Protector activities •Use plastic sheet protectors to create dry erase sheets for students to copy words . You can place phonogram sheets from the lesson in the sheet protectors and let the student complete the work this way. Phonics Bingo •Play games of phonics bingo. Dictation-On a separate piece of lined paper •When dictating phonograms make sure to say all the sounds each phonogram makes. When dictating sentences say each word in the sentence slowly allowing students time to sound out and write the words. Once the students have written the complete sentence, say it again slowly allowing students to check their work. You can gradually increase the pace as the students are ready. Read Aloud •We recommend daily read aloud time. Set aside 15-30 minutes per day for reading and discussion/narration.Materials•Winnie the Pooh Chapters 1-2 by A. A MilneRead AloudConsult Reader Guides for helpful vocabulary and comprehension questions.

Lesson 2A©2023 Classical School Solutions31Phonics Practicequ-i-tquitqu-i-pquipqu-i-zquizqu-e-llquellqu-i-llquillqu-i-l-tquiltReview Phonogram quRead to the students: A phonogram is a letter or group of letters that represent a sound. The phonogram qu says /kw/ as in quit. First read each sound in the words below, then put them together to read the word. Say to the students: Practice reading the sentences below. Quinn can nap.Quinn can nap with the quilt.Quinn has a quilt.Review Phonograms 1-31 from Level K with the students each day.Dictation: Phonograms: EE “E double E always says /E/, TH /th/ /TH/, U /u/ /U/ /OO/, I /i/ /I/ /E/ Sentence of the day: Dan has a Net.

Lesson 2A©2023 Classical School Solutions32Ending Blends n+dRead to the student: Now we will work on ending blends. Blends are two or more consonants that each say their own sound but say them very close together. Point to the first word below with the n+d blend and have the student practice saying the blend after you. Make sure they say the sounds the letters make together and not the letter names.b-a-n-dbandb-e-n-dbendh-a-n-dhandl-a-n-dlands-a-n-dsandw-i-n-dwindb-u-n-kbunkd-u-n-kdunkh-o-n-khonkj-u-n-kjunks-k-u-n-kskunkt-r-u-n-ktrunkRead to the student: Trace and fill in the missing letters below. Sound out the word as you write. Read to the student: Rewrite the word “hand” below but change the /h/ to an /l/. Then read your new word.Read to the student: Rewrite the word “band” below but leave out the /b/. Then read your new word.Read to the student: Rewrite the word “sand” below but change the /s/ to a /w/. Then read your new word. *Remember the 3rd sound of A is /ah/3Phonics Practice

Lesson 2A©2023 Classical School Solutions33 MidlineShort Line Letters Read to the student: Today we will practice short line letters. The short line letters begin at the midline and go down to the baseline. Trace the letters below and then write your own starting on the dot. Remember to practice the sounds as you write. N-/n/ M-/m/ U- /u/ /U/ /OO/ Add rain and puddles to complete the scene. Color the picture.

Lesson 2A©2023 Classical School Solutions34Parts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Read the following words aloud to your student and have them draw or place a black triangle above all the nouns. Example: i ran to hug jan. IJGrammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounNoun VerbPersonalNounNoun VerbPersonalNounPPPCapitalization and punctuation: Correct the sentence below: Read to the student: Capitalize the first letter of the first word of every sentence. Capitalize someone’s name. Place a period (.) at the end of a sentence. dan runs fast on the sand netfastpondsand

Lesson 2B©2023 Classical School Solutions35Auditory Exercise—Blending Say to the student: I’m going to say four sounds. I want you to put the sounds together to say a word. Each time you say a sound, put one finger up. Then say the sounds together. The sounds are /b/, /l/, /o/, /b/.•/s/+/l/+/i/+/p/ = slip •/h/+/u/+/l/+/k/ = hulk •/d/+/r/+u/+/m/ = drum •/s/+/e/+/n/+/d/ = send •/w/+/i/+/m/+/p/ = wimpReading Warm Up: Have your child point to each phonogram and say the sounds. /b/Reading Warm Up: Have your child point to each phonogram and say the sounds. /l/Reading Warm Up: Have your child point to each phonogram and say the sounds. /o/= blobReading Warm Up: Have your child point to each phonogram and say the sounds. Sight Word Practice: Point to each word above and have the child say the sight word. 2/b/Reading Warm Up: Have your child point to each phonogram and say the sounds. y y2y3y4p-l-a-nplanp-l-u-mplump-l-o-pplopp-l-o-tplotp-l-u-splusp-r-a-mpramp-r-e-pprepp-r-i-mprimp-r-o-mpromp-r-o-ppropReading Warm Up: Have your child point to each phonogram and say the sounds. y y2y3y4p-l-a-nplanp-l-u-mplump-l-o-pplopp-l-o-tplotp-l-u-splusp-r-a-mpramp-r-e-pprepp-r-i-mprimp-r-o-mpromp-r-o-ppropRead to the student: Now we are going to talk about a tricky fellow called “Sly Y." Sly Y has four different sounds /y/ /i/ /I/ /E/. Most phonograms say their first sound most of the time and if you see “Sly Y” at the beginning of a word he says /y/ as in “yes” or “yo-yo”. “Sly Y” will sometimes hide out at the end of a word and pretend to be a vowel. Point to sounds of Y below and have your student repeat the sounds /y/ /i/ /I/ /E//y/ /i/ /I/ /E/Read to the student: Read the picture sentences below with the sound of “Sly Y.”This is a .Reading Warm Up: Have your child point to each phonogram and say the sounds. y y2y3y4p-l-a-nplanp-l-u-mplump-l-o-pplopp-l-o-tplotp-l-u-splusp-r-a-mpramp-r-e-pprepp-r-i-mprimp-r-o-mpromp-r-o-ppropThis is my .3Reading Warm Up: Have your child point to each phonogram and say the sounds. y y2y3y4p-l-a-nplanp-l-u-mplump-l-o-pplopp-l-o-tplotp-l-u-splusp-r-a-mpramp-r-e-pprepp-r-i-mprimp-r-o-mpromp-r-o-ppropThe is by my .Reading Warm Up: Have your child point to each phonogram and say the sounds. y y2y3y4p-l-a-nplanp-l-u-mplump-l-o-pplopp-l-o-tplotp-l-u-splusp-r-a-mpramp-r-e-pprepp-r-i-mprimp-r-o-mpromp-r-o-ppropReading Warm Up: Have your child point to each phonogram and say the sounds. y y2y3y4p-l-a-nplanp-l-u-mplump-l-o-pplopp-l-o-tplotp-l-u-splusp-r-a-mpramp-r-e-pprepp-r-i-mprimp-r-o-mpromp-r-o-pprop33Phonics PracticeReview Phonograms 1-31 from Level K with the students each day.Daily Dictation: Phonograms of the day: SH /sh/, X /x/, AR /ar/, X /x/ Sentence of the day: See the dog run.

Lesson 2B©2023 Classical School Solutions36b-u-m-pbumpc-a-m-pcampd-u-m-pdumph-u-m-phumpj-u-m-pjumpl-i-m-plimpl-a-m-plampl-u-m-plumpr-a-m-prampr-u-m-prumpt-e-m-ptempw-i-m-pwimpEnding Blends m+pRead to the student: Let’s review ending blends. Blends are two or more consonants that each say their own sound but say them very close together. Point to the first word below with the m+p blend and have the student practice saying the blend after you. Make sure they say the sounds the letters make together and not the letter names.Read to the student: Practice reading the sentences below. Jan can run.Jan will jump and skip.Jan can jump.Phonics Practice

Lesson 2B©2023 Classical School Solutions37Nursery RhymeBoys and girls, come out to play, The moon doth shine as bright as day, Leave your supper and leave your sleep, Come with your play-fellows into the street. Oral Exercise — What shines as bright as day? Have your parent or teacher read the first two lines and you try to repeat them.Say the poem daily and have the students learn by heart for recitation. Recitation Is recommended for the end of the week. Have the students recite the poem chorally and a few students can be selected to present the poem in a small group or individually.

Lesson 2B©2023 Classical School Solutions38MidlineShort Line Letters MidlineShort Line Letters Read to the student: Today we will practice short line letters. The short line letters begin at the midline and go down to the baseline. Trace the letters below and then write your own starting on the dot. Remember to practice the sounds as you write. Y-/y/ /i/ /I/ /E/ J-/j/ P- /p/ Draw apples on the tree. Color the picture.

Lesson 2B©2023 Classical School Solutions39Parts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Read the following words aloud to your student and have them draw or place a black triangle above all the nouns. Example: i ran to hug jan. IJGrammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounNoun VerbPersonalNounNoun VerbPersonalNounPPPCapitalization and punctuation: Correct the sentence below: Read to the student: Capitalize the first letter of the first word of every sentence. Capitalize someone’s name. Place a period (.) at the end of a sentence. meg runs and jumps jumphopsunMeg

Lesson 2C©2023 Classical School Solutions40Phonics PracticePhoneme Substitution - Middle Say to the student: We are going to play a sound puzzle game. I am going to say a word and then I will ask you to take away a sound and put a new sound in its place. For example: The word is “hat”. Take away the /a/ and use the /o/ sound in its place. Now your word is “hot”.•pack - /a/ + /i/ = (pick) •slip - /i/ + /a/ = (slap) •mock - /o/ + /u/ = (muck) •spit - /i/ + /o/ = (spot) •stamp - /a/ + /u/ = (stump)Review Phonograms 1-31 from Level K with the students each day.Daily Dictation: Phonograms of the day: SH /sh/, QU /kw/, I /i/ /I/ /E/, O /o/ /O/ /oo/ /u/ Sentence of the day: Dot is hot a lot.Read to the student: Trace and fill in the missing letters below. Sound out the word as you write. Read to the student: Rewrite the word “jump” below but change the /j/ to a /b/. Then read your new word.Read to the student: Rewrite the word “stamp” below but change the /a/ to an /u/. Then read your new word.Read to the student: Rewrite the word “lamp” below but change the /l/ to a /d/. Then read your new word.

Lesson 2C©2023 Classical School Solutions41Phonics PracticepestprisspassslamstemslimspinspillspitkillkitkissspotspatsnapbellbillbullHave the student read the words, circle the word that matches the picture and then write the

Lesson 2C©2023 Classical School Solutions42Handwriting Dash Line Letters Dash ForwardRead to the student: Today we will practice dash line letters. The dash line letters begin at the midline or between the midline and the baseline. Trace the letters below and then write your own starting on the dot. Remember to practice the sounds as you write. E-/e/ /E/ Z-/z/ Dash Line Letters Dash Forward9/28/2020 Hen on Nest with Chicks coloring page | Free Printable Coloring Pageswww.supercoloring.com/coloring-pages/hen-on-nest-with-chicks 1/1Draw a nest for the chicken and her chicks. Color the picture.

Lesson 2C©2023 Classical School Solutions43Parts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Read the following words aloud to your student and have them draw or place a black triangle above all the nouns. Example: i ran to hug jan. IJGrammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounNoun VerbPersonalNounNoun VerbPersonalNounPPPCapitalization and punctuation: Correct the sentence below: Read to the student: Capitalize the first letter of the first word of every sentence. Capitalize someone’s name. Place a period (.) at the end of a sentence. stan ran as fast as he can wentdogBofast

Lesson 2D©2023 Classical School Solutions44Phoneme Substitution - Middle Say to the student: We are going to play a sound puzzle game. I am going to say a word and then I will ask you to take away a sound and put a new sound in its place. For example: The word is “hat”. Take away the /a/ and use the /o/ sound at the beginning. Now your word is “hot”.•last - /a/ + /o/ = (lost) •crush - /u/ + /a/ = (crash) •flop - /o/ + /a/ = (flap) •send - /e/ + /a/ = (sand) •stick - /i/ + /u/ = (stuck)Phonics PracticeReview Phonograms 1-31 from Level K with the students each day.Daily Dictation: Phonograms of the day: Y /y/ /i/ /I/ /E/, QU /kw/, SH /sh/, U /u/ /U/ /OO/ Sentence of the day: See it drip and melt.Read to the student: Trace and fill in the missing letters below. Sound out the word as you write. Read to the student: Rewrite the word “tent” below but change the first /t/ to a /v/. Then read your new word.Read to the student: Rewrite the word “hunt” below but change the /h/ to a /p/. Then read your new word.Read to the student: Rewrite the word “mint” below but change the /t/ to a /d/. Then read your new word. *Remember the 2nd sound of I is /I/2

Lesson 2D©2023 Classical School Solutions45Phonics PracticeRead to the students: Using a red crayon, color the vowels and the “Sly Ys” in the words below. Color the vowels and the “Sly Ys” red. Mark a “3” over the y’s to show that Sly Y is making his third sound. The first two have been completed for you as an example. Read the words out loud as you b-e-ll b-i-ll d-o-llh-u-ff j-i-ff m-u-ffk-i-ss l-e-ss m-e-ssThe frog had a fly for a snack.3Have the students read the sentence below.3

Lesson 2D©2023 Classical School Solutions46HandwritingTop Line Letters ltbhkTop Line Letters ltbhkRead to the student: Today we will practice top line letters. The top line letters begin at the top line and go down to the baseline. Trace the letters below and then write your own starting on the dot. Remember to practice the sounds as you write. L-/n/ t-/t/ B- /b/ H- /h/ Complete the leaf mazes below.

Lesson 2D©2023 Classical School Solutions47Picture StudyThe Children Set Sail With Music by Willy PoganyRead to the child: Let’s explore this picture. How many children are in the picture?What are the children doing? Are they happy or sad? What song do you think they are singing? Find a horn. Find a picture of a bird. Make up a story to tell you parent that starts: Once upon a time the children set sail for…

Lesson 2D©2023 Classical School Solutions48Parts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Read the following words aloud to your student and have them draw or place a black triangle above all the nouns. Grammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounNoun VerbPersonalNounNoun VerbPersonalNounPPPExample: i ran to hug jan. IJCapitalization and punctuation: Correct the sentence below: Read to the student: Capitalize the first letter of the first word of every sentence. Capitalize someone’s name. Place a period (.) at the end of a sentence. clint has a pet dog flint goldrompFlintgift

TEACHER’S NOTESLesson 3A, 3B, 3C, 3D©2023 Classical School Solutions49Phonograms we are working on this week: Review-EE Handwriting: Slant Stroke Letters Nursery Rhyme: “This Little Pig Went to Market” See The Bees Reader•Dry Erase Boards"•Letter Tiles"•Plastic Sheet Protectors"Readers In Rhyme Teal Set 21-30"• 23. See the Bees"Letter Tiles • Guide students to sound out their phonogram tiles to build words from the lesson. You can do this as a class (guided) to begin with and slowly move it to independent work. Dry Erase Board activities •Guide students to sound out and write words from each lesson onto their dry erase board. You can do this as a class (guided) to begin with and slowly move it to independent work. Plastic Sheet Protector activities •Use plastic sheet protectors to create dry erase sheets for students to copy words . You can place phonogram sheets from the lesson in the sheet protectors and let the student complete the work this way. Phonics Bingo •Play games of phonics bingo. Dictation-On a separate piece of lined paper •When dictating phonograms make sure to say all the sounds each phonogram makes. When dictating sentences say each word in the sentence slowly allowing students time to sound out and write the words. Once the students have written the complete sentence, say it again slowly allowing students to check their work. You can gradually increase the pace as the students are ready. Read Aloud •We recommend daily read aloud time.. Set aside 15-30 minutes per day for reading and discussion/narration.MaterialsRead AloudConsult Reader Guides for helpful vocabulary and comprehension questions.•Winnie the Pooh Chapters 3-4 by A. A Milne

Lesson 3A©2023 Classical School Solutions501. I see a bee by the tree.2. The tan jeep went beep beep!3. The tree is ten feet tall.Read the sentences below. All phonograms have been underlined for you. The sounds of vowels and “Sly Y” are marked above. Y says /y/ /i/ /I/ /E/, A says /a/ /A/ /ah/33Phonics PracticeDaily Dictation: Phonograms: A /a/ /A/ /ah/, EE “E” double E always says /E/, QU /kw/, V /v/, X /x/ Sentence of the day: I fly up to the sky.Have the student point to the phonograms and say their sounds.Reading Warm Up: Have your child point to each phonogram and say the sounds. s-eeseet-r-eetreeb-eebeeb-ee-pbeepf-ee-dfeedw-ee-kweekPhonogram eeRead to the student: The phonogram ee says E double E always says E as in bee or see. Have the student repeat it back “E double E always says E”. First read each sound in the words below, then put them together to read the word.

Lesson 3A©2023 Classical School Solutions51s\\\dsf\\\ttr\\\d\\\rb\\\j\\\pRead to the student: Use the phonogram ee to make words below. Underline the double ee phonogram in each word. Write the words, sound out the words and then match each word with the correct picture.Phonics Practice

Lesson 3A©2023 Classical School Solutions52 Slant Stroke Letters Slant DownDash Line Letters Dash Forward Handwriting Slant Stroke Letters Slant DownDash Line Letters Dash Forward Draw a big flower for the bee. Color the picture.Read to the student: The dash line letters begin at the midline or between the midline and the baseline. Trace the letters below and then write your own starting on the dot. Remember to practice the phonogram sound as you write. “E double E always says E” Read to the student: The slant stroke letters begin at the midline and slant down to the baseline. Trace the letters below and then write your own starting on the dot. Trace the letters below and then write your own starting on the dot. Remember to practice the sounds as you write. V-/v/ W-/w/

Lesson 3A©2023 Classical School Solutions53Grammarthe bee’s name is bill bee hive fly wing Parts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Read the following words aloud to your student and have them draw or place a black triangle above all the nouns. Grammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounNoun VerbPersonalNounNoun VerbPersonalNounPPPExample: i ran to hug jan. IJCapitalization and punctuation: Correct the sentence below: Read to the student: Capitalize the first letter of the first word of every sentence. Capitalize someone’s name. Place a period (.) at the end of a sentence.

Lesson 3B©2023 Classical School Solutions54qu-ee-nqueenqu-i-tquitqu-i-l-tquilt1. I see the queen in the green grass.2. I am on a quest to see a deer.3. The squid and eel are by the reef.Read the sentences below. All phonograms have been underlined for you. The sounds of vowels and “Sly Y” are marked above. Y says /y/ /i/ /I/ /E/.3Phonics PracticeDictation: Phonograms: AR /ar/, EE “E double E always says /E/, I /i/ /I/ /E/, O /o/ /O/ /oo/ /u/ Sentence of the day: Stan had a plan.Have the student point to the phonograms and say their sounds.Phonogram quRead to the student: The phonogram qu says /kw/ as in “quit”. First read each sound in the words below, then put them together to read the word.

Lesson 3B©2023 Classical School Solutions55Read to the student: Add ee or qu to form words below. Read the words out loud as you write them. fl\\ b\\p\\estd\\p s\\intt\\nstr\\tgr\\nI see the queen .\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\Reading Warm Up: Have your child point to each phonogram and say the sounds. s-eeseet-r-eetreeb-eebeeb-ee-pbeepf-ee-dfeedw-ee-kweekHave the student write out the picture sentence below. Make sure the student writes out the words represented by the pictures. Phonics Practice

Lesson 3B©2023 Classical School Solutions56PoetrySay the poem daily and have the students learn by heart for recitation. Recitation Is recommended for the end of the week. Have the students recite the poem chorally and a few students can be selected to present the poem in a small group or individually.THIS little pig went to market; This little pig stayed at home; This little pig had roast beef; This little pig had none; This little pig said, ‘Wee, wee, wee! I can’t find my way home!” Oral Exercise — Where did Little Pig One go? What did Little Pig Three eat? Underline all of the ee phonograms in the rhyme.

Lesson 3B©2023 Classical School Solutions57 Slant Stroke Letters Slant Down Read to the student: Today we will practice slant stroke letters. The slant stroke letters begin at the midline and slant down to the baseline. Trace the letters below and then write your own starting on the dot. Remember to practice the sounds as you write. X-/ks/ V-/v/ Slant Stroke Letters Slant Down HandwritingRead to the student: The clock stroke letters begin at 2 O’clock and go around the clock. When Q and U are together they say /kw/ and in queen. Remember to practice the sound as you write QU /kw/ Slant Stroke Letters Slant Down Draw happy little bees all around the queen. Color the picture.

Lesson 3B©2023 Classical School Solutions58Grammarthe queen ate tarts tartqueenatetreeParts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Read the following words aloud to your student and have them draw or place a black triangle above all the nouns. Grammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounNoun VerbPersonalNounNoun VerbPersonalNounPPPExample: i ran to hug jan. IJCapitalization and punctuation: Correct the sentence below: Read to the student: Capitalize the first letter of the first word of every sentence. Capitalize someone’s name. Place a period (.) at the end of a sentence.

Lesson 3C©2023 Classical School Solutions59Phonics PracticeThe wee bees are glad to see the queen.Daily Dictation: Phonograms: SH /sh/, QU /kw, EE “E double E always says /E/”, U /u/ /U/ /OO/ Sentence of the day: The swan swam to me.Have the student point to the phonograms and say their sounds.Read to the student: How many words can you make with the phonogram “ee” using the letters in the boxes below.\ee\ \ee\\ee\ \ee\\ee\ \ee\\ee\ \ee\sntdrf

Lesson 3C©2023 Classical School Solutions60peekpenpeelskinsquidsquintseeseepsweepfeeleelfleequiltquitgritquestqueenteenRead to the student: Underline the two letter phonograms in each word. Read the words by each picture and write the word that matches the picture on the line below it. Phonics Practice

Lesson 3C©2023 Classical School Solutions61Handwriting Slant Stroke Letters Slant DownDash Line Letters Dash Forward Complete the maze to help the bee get to the flower.Read to the student: Today we will practice dash line letters. The dash line letters begin at the midline or between the midline and the baseline. Trace the letters below and then write your own starting on the dot. Remember to practice the phonogram sound as you write. “E double E always says E”

Lesson 3C©2023 Classical School Solutions62Grammar i see the beemouseseegocatParts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Read the following words aloud to your student and have them draw or place a black triangle above all the nouns. Grammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounNoun VerbPersonalNounNoun VerbPersonalNounPPPExample: i ran to hug jan. IJCapitalization and punctuation: Correct the sentence below: Read to the student: Capitalize the first letter of the first word of every sentence. Capitalize someone’s name. Place a period (.) at the end of a sentence.

Lesson 3D©2023 Classical School Solutions63Phonics PracticeDaily Dictation: Phonograms: EE “E double E always says /E/”, QU /kw/, SH /sh/, AR /ar/ Sentence of the day: I saw a jar of jam.Have the student point to the phonograms and say their sounds.The queen keeps her bees at the top of the green trees.Read to the student: Using red and blue crayons, color the vowel pair phonograms red and all other phonograms blue. If “Sly Y” is pretending to sound like a vowel, color him red. Use your phonogram tiles above to check your work. The first two have been completed for you as an example.

Lesson 3D©2023 Classical School Solutions64freebeeseendeerteendeepsweetneedquizquiltquestsquintstartfinishRead to the student: The bees have been very busy making honey. Follow the trail of the bees and read all of the double E and QU words to collect all the jars of honey. Use pasta, coins, tokens and have the student place them on each word as they read.Phonics Practice

Lesson 3D©2023 Classical School Solutions65Handwriting Color the picture.Read to the student: The clock stroke letters begin at 2 O’clock and go around the clock. When Q and U are together they say /kw/ and in queen. Remember to practice the sound as you write QU /kw/

Lesson 3D©2023 Classical School Solutions66Picture StudyRead to the student: Let’s explore this picture. who is in the picture? Are they happy or sad? Why do you think so? Is there an animal in the picture? What do you think the lady’s name is? Find a bee. Count how many golden tassels are in the picture. (You may wish to look up the story of this illustration. It is from the Queen Bee Grimm's Fairy Tales)

Lesson 3D©2023 Classical School Solutions67Grammarthe queen sleepsParts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Find three nouns in the picture study on the previous page. Draw or place a triangle on the nouns in the picture. Capitalization and punctuation: Rewrite the sentence correctly. Read to the student: Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a period (.).

TEACHER’S NOTESLesson 4A, 4B, 4C, 4D©2023 Classical School Solutions68Phonograms we are working on this week: Review-TH Handwriting: Top Line Letters Nursery Rhyme: “Three Little Kittens” Popular English Nursery Rhyme Seth and Cass Reader•Dry Erase Boards"•Letter Tiles"•Plastic Sheet Protectors"Readers In Rhyme Teal Set 21-30"• 24. Seth and Cass"Letter Tiles • Guide students to sound out their phonogram tiles to build words from the lesson. You can do this as a class (guided) to begin with and slowly move it to independent work. Dry Erase Board activities •Guide students to sound out and write words from each lesson onto their dry erase board. You can do this as a class (guided) to begin with and slowly move it to independent work. Plastic Sheet Protector activities •Use plastic sheet protectors to create dry erase sheets for students to copy words . You can place phonogram sheets from the lesson in the sheet protectors and let the student complete the work this way. Phonics Bingo •Play games of phonics bingo. Dictation-On a separate piece of lined paper •When dictating phonograms make sure to say all the sounds each phonogram makes. When dictating sentences say each word in the sentence slowly allowing students time to sound out and write the words. Once the students have written the complete sentence, say it again slowly allowing students to check their work. You can gradually increase the pace as the students are ready. Read Aloud •We recommend daily read aloud time.. Set aside 15-30 minutes per day for reading and discussion/narration.Materials•Winnie the Pooh Chapters 5-6 by A. A MilneRead AloudConsult Reader Guides for helpful vocabulary and comprehension questions.

Lesson 4A©2023 Classical School Solutions69Phonics PracticeDaily Dictation: Phonograms of the day: TH /th/ /TH/, QU /kw, Y /y/ /i/ /I/ /E/, U /u/ /U/ /OO/ Sentence of the day: The dog went yap, yap.Have the student point to the phonograms and say their sounds.Reading Warm Up: Have your child point to each phonogram and say the sounds. m-o-thmothp-a-thpathth-u-dthudth-e-f-ttheftc-l-o-thclothw-i-thwithth -i-sthisth -e-nthenth -a-tthatth -e-mthemReview Phonogram thRead to the student: The phonogram th says /th/- /th/ as in “thin” and “this”. First read each sound in the words below, then put them together to read the word.th’s first sound is /th/ as in:th’s second sound is /th/ as in:Reading Warm Up: Have your child point to each phonogram and say the sounds. m-o-thmothp-a-thpathth-u-dthudth-e-f-ttheftc-l-o-thclothw-i-thwithth -i-sthisth -e-nthenth -a-tthatth -e-mthem2222

Lesson 4A©2023 Classical School Solutions70withmathmoththinthumbthugbaththankmathpathclothslothHave the student read the words, circle the word that matches the picture and then write the Read the sentences below. All phonograms have been underlined for you.1. The cat had three naps on my bed.2. Beth walks on the path by the pond.3. Seth lost three teeth this month.4. I see a dog that needs a bath.23323222Phonics Practice

Lesson 4A©2023 Classical School Solutions71Handwriting Top Line Letters ltbhk Top Line Letters ltbhkRead to the student: The top line letters begin at the top line and go down to the baseline. Trace the letters below and then write your own starting on the dot. Remember to practice the phonogram sounds as you write. Draw a path for the pigs to follow. Color the Picture

Lesson 4A©2023 Classical School Solutions72Grammarthe big pig’s name was ben pig path wentoff Parts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Read the following words aloud to your student and have them draw or place a black triangle above all the nouns. Grammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounNoun VerbPersonalNounNoun VerbPersonalNounPPPExample: i ran to hug jan. IJCapitalization and punctuation: Correct the sentence below: Read to the student: Capitalize the first letter of the first word of every sentence. Capitalize someone’s name. Place a period (.) at the end of a sentence.

Lesson 4B©2023 Classical School Solutions73Phonics PracticeDaily Dictation: Phonograms of the day: AR /ar/, TH /th/ /TH/, S /s/ /z/, O /o/ /O/ /oo/ /u/ Sentence of the day: Jen and Ben are twins.Have the student point to the phonograms and say their sounds.Read to the student: Add th to form words below. Read the words out loud as you write them. The th phonogram is underlined to help you remember if it’s the first or second sound of th.birthmathmoththreadthreedeathbankthankbathepathearthworthSeth the sloth spends most of the month in this tree.tee\\\\eftfif\\\\em\\at\\anbro\\ma\\222

Lesson 4B©2023 Classical School Solutions74sudsrugfeetdogbathtubdrycloththumbtreegreenquitwetthemcrythree\\\\\\\\Write an “ee” word.\\\\\\\\\\\\\\\\Choose words from the list that are found in the picture and write them below.Write a “Sly Y” word.Write an “th” word.\\\\\\\\Write a what you think the dog’s name is:Study the picture below with the student. Have the student read the list of words and and circle words that that are found in the picture. 33Phonics Practice

Lesson 4B©2023 Classical School Solutions75Three little kittens, they lost their mittens And they began to cry "Oh, mother dear, we sadly fear We've lost our mittens by" "What! Lost your mittens? you naughty kittens Then you shall have no pie" "Meow, meow, meow, my" Three little kittens, they found their mittens And they began to cry "Oh, mother dear, see here, see here We've found our mittens by" "Put on your mittens, you silly kittens And you shall have some pie" "Meow, meow, meow, my" Three little kittens put on their mittens And soon ate up the pie "Oh, mother dear, we greatly fear We've soiled our mittens by" "What! Soiled your mittens? You naughty kittens" Then they began to sigh "Meow, meow, meow, my" Three little kittens, they washed their mittens And hung them out to dry "Oh, mother dear, do you not hear We've washed our mittens by?" "What! Washed your mittens? Then you're good kittens And you shall have more pie" "Meow, meow, meow, my"PoetrySay the poem daily and have the students learn by heart for recitation. Recitation Is recommended for the end of the week. Have the students recite the poem chorally and a few students can be selected to present the poem in a small group or individually.

Lesson 4B©2023 Classical School Solutions76Handwriting Read to the student: The top line letters begin at the top line and go down to the baseline. Trace the letters below and then write your own starting on the dot. Remember to practice the phonogram sounds as you write. Compete the maze below.

Lesson 4B©2023 Classical School Solutions77Grammar little kittens, they lost their mittens and they began cry kitten cry lost mitten Written Exercise - Dictation: Have your student listen as you read the excerpt below of the poem “Three Little Kittens.” Have them fill in the missing words from the options below. Gently have your student erase and correct any mistakes. Be sure to spell all the words correctly. toThreeParts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Read the following words aloud to your student and have them draw or place a black triangle above all the nouns. Grammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounNoun VerbPersonalNounNoun VerbPersonalNounPPP

Lesson 4C©2023 Classical School Solutions78Phonics PracticeDaily Dictation: Phonograms of the day: S /s/ /z/, QU /kw/, AR /ar/, O /o/ /O/ /oo/ /u/ Sentence of the day: See the bees by me. \\iltf\\\tmo\\\ p\\\l\\umbs\\\dsba\\\s\\idtr\\\b\\\Use the picture clues to help you complete the words below. Use your phonogram tiles above to help you if you get stuck. The first one is completed for you as an example.eeHave the student point to the phonograms and say their sounds.

Lesson 4C©2023 Classical School Solutions79Have the student read the th words from the list and then write them in the columns below according to which sound of th the word uses. The first two words have been completed as an example. Have the student practice feeling their voicebox to see which sound of the is made.1. the2. with3. than4. them5. path6. moth7. teeth8. that9. cloth10. thenth’s 1st sound\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\withtheth’s 2nd soundwithmathmoththinthumbthugbaththankmathpathclothslothwithmathmoththinthumbthugbaththankmathpathclothsloth2Phonics Practice

Lesson 4C©2023 Classical School Solutions80Handwriting Clock Letterscogdasf Complete the dot-to-dot.Read to the student: The clock stroke letters begin at 2 O’clock and go around the clock. Trace the letters below and then write your own starting on the dot. Remember to practice the sounds as you write.

Lesson 4C©2023 Classical School Solutions81Grammar i see ned in bednedbedseedogParts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Read the following words aloud to your student and have them draw or place a black triangle above all the nouns. Grammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounNoun VerbPersonalNounNoun VerbPersonalNounPPPExample: i ran to hug jan. IJCapitalization and punctuation: Correct the sentence below: Read to the student: Capitalize the first letter of the first word of every sentence. Capitalize someone’s name. Place a period (.) at the end of a sentence.

Lesson 4D©2023 Classical School Solutions82Phonics PracticeDaily Dictation: Phonograms: TH /th/ /TH/, CK /k/ the 2 letter /k/, A /a/ /A/ /ah/, U /u/ /U/ /OO/ Sentence of the day: Dan has a crab in his net.Have the student point to the phonograms and say their sounds.Read to the student: Using red and blue crayons, color the vowel pair phonograms red and all other phonograms blue. If “Sly Y” is pretending to sound like a vowel, color him red. Use your phonogram tiles above to check your work. The first two have been completed for you as an example.Seth the moth was happy to meet the queen bee.4

Lesson 4D©2023 Classical School Solutions83startfinishthisthanthinkthreemyththeftthudthanktruthclothbrothfifthmothboththat222222Read to the student: Seth the sloth is taking a bath. Read all the th words on the trail of bubbles starting at Seth the sloth. Watch out for vowels that say their second sound and “Sly Y. ”Phonics Practice

Lesson 4D©2023 Classical School Solutions84Handwriting Read to the student: Trace the letters below and then write your own starting on the dot. Remember to practice the phonogram sounds as you write. The three little kittens have lost their mittens. Draw mittens for the kittens.

Lesson 4D©2023 Classical School Solutions85Picture StudyRead to the student: Let’s explore this picture. What are the children doing? What do you think they are supposed to be doing? Do you think it is morning or night? Are the children happy or sad? What do you think will happen if their mother hears them? What do you think the children’s names are?

Lesson 4D©2023 Classical School Solutions86Grammarthe kids jump on the bedParts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Find three nouns in the picture study on the previous page. Draw or place a triangle on the nouns in the picture. Example: i ran to hug jan. IJCapitalization and punctuation: Correct the sentence below: Read to the student: Capitalize the first letter of the first word of every sentence. Capitalize someone’s name. Place a period (.) at the end of a sentence.

TEACHER’S NOTESLesson 5A, 5B, 5C, 5D©2023 Classical School Solutions87Phonograms we are working on this week: Silent E Handwriting: Top Line Letters Nursery Rhyme: “Pat-aCake” Wake Up Jake Reader•Dry Erase Boards"•Letter Tiles"•Plastic Sheet Protectors"Readers In Rhyme Teal Set 21-30"• 25. Wake Up Jake"Letter Tiles • Guide students to sound out their phonogram tiles to build words from the lesson. You can do this as a class (guided) to begin with and slowly move it to independent work. Dry Erase Board activities •Guide students to sound out and write words from each lesson onto their dry erase board. You can do this as a class (guided) to begin with and slowly move it to independent work. Plastic Sheet Protector activities •Use plastic sheet protectors to create dry erase sheets for students to copy words . You can place phonogram sheets from the lesson in the sheet protectors and let the student complete the work this way. Phonics Bingo •Play games of phonics bingo. Dictation-On a separate piece of lined paper •When dictating phonograms make sure to say all the sounds each phonogram makes. When dictating sentences say each word in the sentence slowly allowing students time to sound out and write the words. Once the students have written the complete sentence, say it again slowly allowing students to check their work. You can gradually increase the pace as the students are ready. Read Aloud •We recommend daily read aloud time.. Set aside 15-30 minutes per day for reading and discussion/narration.Materials•Winnie the Pooh Chapters 7-8 by A. A MilneRead AloudConsult Reader Guides for helpful vocabulary and comprehension questions.

Lesson 5A©2023 Classical School Solutions88Phonics PracticeSilent E (Job #1)Slyc-u-b-ecubet-u-b-etuber-u-d-erudem-u-t-emutef-u-s-efusec-u-t-ecuteSilentSilentDictation: Phonograms: G /g/ /j/, TH /th/ /TH/, CK /k/ the 2 letter /k/, EE “E double E always says /E// Sentence of the day: The dog fell in the mud.Have the student point to the phonograms and say their sounds.Read to the student: Let’s learn about silent E. “Silent E” has many jobs. Today we will learn about “Silent E’s” job #1. You will find many words with the pattern consonant/vowel/consonant/e. C/V/C/e. We call these “Silent E” words because the E is silent and it makes the vowel before it say it’s name or it’s second sound. Here is an example. Point to each letter in the word bake and show the consonant/vowel/consonant/e pattern.Reading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJNow practice reading the “silent e” words below. The arrow will remind you that the E is silent and that the vowel before it says its own name.Reading Warm Up: Have your child point to each phonogram and say the sounds. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafeh-a-t-ehates-a-m-esamel-a-n-elanen-a-m-ename

Lesson 5A©2023 Classical School Solutions89Read the sentences below. All phonograms have been underlined for you. The arrows remind you of the “silent e” words.m z c-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPc kc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPc pc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPr kc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPs fc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPgr vc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPFind the missing vowels below. Add the vowel and “Silent E.” Remember, “Silent E” makes the vowel before it say its name.Missing vowels A and “Silent E”Reading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafea-p-eapea-t-eatel-a-n-elanen-a-m-enameReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafea-p-eapea-t-eatel-a-n-elanen-a-m-enameReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafea-p-eapea-t-eatel-a-n-elanen-a-m-enameReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafea-p-eapea-t-eatel-a-n-elanen-a-m-ename1. Jake went to see the cave by the camp.2. I will bake a cake for Jane.3. Dale made a lot of sweets for the bake sale.4. Take care not to be late to see the Queen. Reading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakePhonics Practice

Lesson 5A©2023 Classical School Solutions90Clock Letterscogdasf HandwritingRead to the student: Today we will practice some of the clock stroke letters and their capitals. The clock stroke letters begin at 2 O’clock and go around the clock. Trace the letters below and then write your own starting on the dot. Clock Letterscogdasf Clock LetterscogdasfFinish drawing a cake below and color the picture.

Lesson 5A©2023 Classical School Solutions91GrammarCapitalization and punctuation: Correct the sentence below: Read to the student: Capitalize the first letter of the first word of every sentence. Capitalize someone’s name. Place a period (.) at the end of a sentence. Parts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Read the following words aloud to your student and have them draw or place a black triangle above all the nouns. (jake has a dog named wags dog cat wagcross

Lesson 5B©2023 Classical School Solutions92Phonics Practiceh-i-v-ehiveb-i-k-ebiked-i-v-ediveh-i-d-ehidem-i-l-emilep-i-l-epileNow practice reading the “silent e” words below. The arrow will remind you that the e is silent and that the vowel before it says its own name.h-i-v-ehiveb-i-k-ebiked-i-v-ediveh-i-d-ehidem-i-l-emilep-i-l-epilebakeRead to the student: Let’s learn about silent E. “Silent E” has many jobs. Today we will learn about “Silent E’s” job #1. You will find many words with the pattern consonant/vowel/consonant/e. C/V/C/e. We call these “Silent E” words because the E is silent and it makes the vowel before it say its name or its second sound. Here is an example. Point to each letter in the word hive and show the consonant/vowel/consonant/e pattern.Silent E (Job #1)Slyc-u-b-ecubet-u-b-etuber-u-d-erudem-u-t-emutef-u-s-efusec-u-t-ecuteSilentSilentDaily Dictation: Phonograms of the day: G /g/ /j/, QU /kw/, A /a/ /A/ /ah/, O /o/ /O/ /oo/ /u Sentence of the day: Trent put up a big tent to camp.Have the student point to the phonograms and say their sounds.

Lesson 5B©2023 Classical School Solutions93Read the sentences below. All phonograms have been underlined for you. The arrows remind you of the “silent e” words.b k c-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPh vc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPk tc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPf rc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPh kc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPl mc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPFind the missing vowels below. Add the vowel and silent e. Remember, “silent e” makes the vowel before it say its name.Missing vowels I and “Silent E”bakeh-i-v-ehiveb-i-k-ebiked-i-v-ediveh-i-d-ehidem-i-l-emilep-i-l-epilebakeh-i-v-ehiveb-i-k-ebiked-i-v-ediveh-i-d-ehidem-i-l-emilep-i-l-epilebakeh-i-v-ehiveb-i-k-ebiked-i-v-ediveh-i-d-ehidem-i-l-emilep-i-l-epilec-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIP1. Mike will ride his bike home.2. I went on a one mile hike.3. I like to see the sun rise.4. We had a flat tire on the drive. 5. I like to sit by the camp fire.Reading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakePhonics Practice

Lesson 5B©2023 Classical School Solutions94PoetrySay the poem together daily and have the students learn by heart for recitation. Recitation Is recommended for the end of the week. Have the students recite the poem chorally and a few students can be selected to present the poem in a small group or individually.PAT-A-CAKEPAT-A-CAKE, pat-a-cake, baker ’s man! Bake me a cake as fast as you can; Prick it, and pat it, and mark it with a T, And put it in the oven for Tommy and me. Oral Exercise — How quickly do the children want the baker to make the cake? Underline all of the Silent E words in the rhyme. Play the clapping game and practice the rhyme. Can you say the whole thing by yourself?

Lesson 5B©2023 Classical School Solutions95HandwritingClock Letterscogdasf Read to the student: Today we will practice some of the clock stroke letters and their capitals. The clock stroke letters begin at 2 O’clock and go around the clock. Trace the letters below and then write your own starting on the dot. Finish drawing a kit for the boy to fly.

Lesson 5B©2023 Classical School Solutions96GrammarCapitalization and punctuation: Write the missing words in the poem below: Read to the student: Capitalize the first letter of the first word of every line in a poem. My thoughts are little _________that ________ ____________________ an ocean wide; Parts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Read the following words aloud to your student and have them draw or place a black triangle above all the nouns. (ships wave ride sea

Lesson 5C©2023 Classical School Solutions97Phonics PracticeNow practice reading the “Silent E” words below. The arrow will remind you that the E is silent and that the vowel before it says its own name.r-o-p-eropep-o-k-epokeh-o-l-eholeh-o-m-ehomec-o-n-econev-o-t-evotej-o-k-ejokeb-o-n-ebonebakeh-i-v-ehiveb-i-k-ebiked-i-v-ediveh-i-d-ehidem-i-l-emilep-i-l-epileRead to the student: Let’s learn about silent E. “Silent E” has many jobs. Today we will learn about “Silent E’s” job #1. You will find many words with the pattern consonant/vowel/consonant/e. C/V/C/e. We call these “Silent E” words because the E is silent and it makes the vowel before it say its name or its second sound. Here is an example. Point to each letter in the word rope and show the consonant/vowel/consonant/e pattern.Silent E (Job #1)Slyc-u-b-ecubet-u-b-etuber-u-d-erudem-u-t-emutef-u-s-efusec-u-t-ecuteSilentSilentDaily Dictation: Phonograms of the day: SH /sh/, AR /ar, E /e/ /E/, Y /y/ /i/ /I/ /E/ Sentence of the day: Can I go to the moon?Have the student point to the phonograms and say their sounds.

Lesson 5C©2023 Classical School Solutions98Read the sentences below. All phonograms have been underlined for you. The arrows remind you of the “silent e” words.1. I hope to go home this week.2. I see that the mole dug a hole in the grass.3. I will take a rose home to Mom.4. Jo fell in a hole and broke his bone. Reading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakecoldconecovenonopenoseroperoserollboneboldbothHave the student read the words, circle the word that matches the picture and then write the Phonics Practice

Lesson 5C©2023 Classical School Solutions99HandwritingClock Letterscogdasf Read to the student: Today we will practice some of the clock stroke letters and their capitals. The clock stroke letters begin at 2 O’clock and go around the clock. Trace the letters below and then write your own starting on the dot. Draw ice cream for the cones. Color the picture.

Lesson 5C©2023 Classical School Solutions100GrammarCapitalization and punctuation: Correct the sentence below: Read to the student: Capitalize the first letter of the first word of every sentence. Capitalize someone’s name. Place a period (.) at the end of a sentence. Parts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Read the following words aloud to your student and have them draw or place a black triangle above all the nouns. (i see the sun in the sky sun sky in wake

Lesson 5D©2023 Classical School Solutions101Phonics Practicebakeh-i-v-ehiveb-i-k-ebiked-i-v-ediveh-i-d-ehidem-i-l-emilep-i-l-epileNow practice reading the “silent e” words below. The arrow will remind you that the E is silent and that the vowel before it says its own name.c-u-b-ecubet-u-b-etuber-u-d-erudem-u-t-emutef-u-s-efusec-u-t-ecuteRead to the student: Let’s learn about silent E. “Silent E” has many jobs. Today we will learn about “Silent E’s” job #1. You will find many words with the pattern consonant/vowel/consonant/e. C/V/C/e. We call these “Silent E” words because the E is silent and it makes the vowel before it say its name or its second sound. Here is an example. Point to each letter in the word cube and show the consonant/vowel/consonant/e pattern.Silent E (Job #1)Slyc-u-b-ecubet-u-b-etuber-u-d-erudem-u-t-emutef-u-s-efusec-u-t-ecuteSilentSilentDaily Dictation: Phonograms: SH /sh/, U /u/ /U/ /OO/, EE “E double E always says /E/”, S /s/ /z/ Sentence of the day: Jan is so fast.Have the student point to the phonograms and say their sounds.

Lesson 5D©2023 Classical School Solutions102Missing Letters: Silent EUse vowels to fill in the missing letters. Remember, “Silent E” makes the vowel before it say its name.The first one is completed for you as an example.in n c-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPev n c-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPf v c-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPt b c-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPst v c-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPbr d c-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPc b c-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPr d c-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPc-o-d-ecoden-o-s-enoser-o-s-erosep-o-k-epokec-u-b-ecubet-u-b-etubem-u-l-emulet-u-n-etuneRIPRead the sentences below. All phonograms have been underlined for you. The arrows remind you of the “silent e” words.1. Cole likes to run up the sand dune.2. Mike will ride an old a mule.3. Kate will bake a cute cake.4. Jude can be a rude brute at times. Reading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakePhonics Practice

Lesson 5D©2023 Classical School Solutions103 HandwritingClock Letterscogdasf Read to the student: Today we will practice some of the clock stroke letters and their capitals. The clock stroke letters begin at 2 O’clock and go around the clock. Trace the letters below and then write your own starting on the dot. Help the dog drive his car to the finish line. Color the picture.

Lesson 5D©2023 Classical School Solutions104Picture StudyRead to the student: Let’s explore this picture. How many children are in the picture?What are the children doing? Do they look bored or afraid? Why do you think so? Do you think it a windy or calm day? Is this the city or the country? What do you think the children’s names are?

Lesson 5D©2023 Classical School Solutions105GrammarCapitalization and punctuation: Correct the sentence below: the kite is in the skyParts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Find three nouns in the picture study on the previous page. Draw or place a triangle on the nouns in the picture.

TEACHER’S NOTESLesson 6A, 6B, 6C, 6D©2023 Classical School Solutions106Phonograms we are working on this week: SH Handwriting: Top Line Letters Nursery Rhyme: “The Birdies Bath” Shep and Shelly Reader•Dry Erase Boards"•Letter Tiles"•Plastic Sheet Protectors"Readers In Rhyme Teal Set 21-30"• 26. Shep and Shelly"Letter Tiles • Guide students to sound out their phonogram tiles to build words from the lesson. You can do this as a class (guided) to begin with and slowly move it to independent work. Dry Erase Board activities •Guide students to sound out and write words from each lesson onto their dry erase board. You can do this as a class (guided) to begin with and slowly move it to independent work. Plastic Sheet Protector activities •Use plastic sheet protectors to create dry erase sheets for students to copy words . You can place phonogram sheets from the lesson in the sheet protectors and let the student complete the work this way. Phonics Bingo •Play games of phonics bingo. Dictation-On a separate piece of lined paper •When dictating phonograms make sure to say all the sounds each phonogram makes. When dictating sentences say each word in the sentence slowly allowing students time to sound out and write the words. Once the students have written the complete sentence, say it again slowly allowing students to check their work. You can gradually increase the pace as the students are ready. Read Aloud •We recommend daily read aloud time.. Set aside 15-30 minutes per day for reading and discussion/narration.Materials•Winnie the Pooh Chapters 9-10 by A. A MilneRead AloudConsult Reader Guides for helpful vocabulary and comprehension questions.

Lesson 6A©2023 Classical School Solutions107Phonics PracticeReading Warm Up: Have your child point to each phonogram and say the sound. f-i-shfishd-i-shdishsh-e-llshellsh-o-pshopsh-i-pshipsh-ee-psheepRead to the student: The phonogram sh says /sh/ as in “fish”. Read the sh words below. First read each sound in the words below, then put them together to read the word. Phonogram shRead the sentences below. All phonograms have been underlined for you. The arrows remind you of the “silent e” words.1. Josh will fish for bass in the pond.2. The small ship made a big splash in the lake.3. I like to sit on the grass in the shade of the tree.4. I will make a dish of crab in fish broth.Reading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeDaily Dictation: Phonograms of the day: I /i/ /I/ /E/, C /c/ /s/, Y /y/ /i/ /I/ /E/, TH /th/ /TH/ Sentence of the day: Dad and I will go see the fish.Have the student point to the phonograms and say their sounds.

Lesson 6A©2023 Classical School Solutions108shopshipshapesashrashdashrashsplashcashfishhushdishflushfishflashrashcashwishHave the student read the words, circle the word that matches the picture and then write the Reading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakePhonics Practice

Lesson 6A©2023 Classical School Solutions109Handwriting Trace the letters and then write your own starting on the dot. Trace the sh Phonograms and then write your own starting on the dots.Draw an underwater scene surrounding the fish.Trace the sentence below.

Lesson 6A©2023 Classical School Solutions110GrammarCapitalization and punctuation: Rewrite the sentence correctly. Read to the student: Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a period (.).Parts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. A PROPER noun is the name of a PARTICULAR person place or thing. Play the grammar game below by making up a proper noun for the common nouns below: Play the grammar game. Read the following words aloud to your student and have them tell a proper noun to fill in each blank space. (girl Ptree Pstreet Pship TitanicPGrammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounP jon went to the game

Lesson 6B©2023 Classical School Solutions111Phonics PracticeRead to the student: How many words can you make with the phonogram “sh” using the vowels in the boxes below.eiouaThe cats are happy to see the dish full of fish.Daily Dictation: Phonograms: Y /y/ /i/ /I/ /E/, O /o/ /O/ /oo/ /u/, K /k/, CK /k/ the 2 letter /k/ Sentence of the day: My cat is so fat.c\\sh br\\shf\\sh fr\\shp\\sh cr\\shm\\sh fl\\shHave the student point to the phonograms and say their sounds.

Lesson 6B©2023 Classical School Solutions112fishashfeettentbathsmilefireclothmothtreegreenhappywetthemdrythree\\\\\\\\Write an “ee” word.\\\\\\\\\\\\\\\\Choose words from the list that are found in the picture and write them below.Write a “sh” word.Write a “Silent E” word.\\\\\\\\Study the picture below with the student. Have the student read the list of words and and circle words that that are found in the picture. 43Reading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeWrite a “th” word.Phonics Practice

Lesson 6B©2023 Classical School Solutions113PoetrySplashety splash in the birdies' bath, How Robin splutters about! Swishety swash with his little brown wings, Till he's clean as a whistle, no doubt. Then out on the stump of the old apple tree, In the warmth of the bright shiny sun. With his neat little bill his feathers he combs. Till they're all nice and dry every one. The Birdies’ BathSay the poem together daily and have the students learn by heart for recitation. Recitation Is recommended for the end of the week. Have the students recite the poem chorally and a few students can be selected to present the poem in a small group or individually.

Lesson 6B©2023 Classical School Solutions114HandwritingTrace the letters and then write your own starting on the dot. Trace the sh Phonograms and then write your own starting on the dots. Draw a birdbath for the bird to sit on. Add grass and trees to complete the scene.

Lesson 6B©2023 Classical School Solutions115GrammarCapitalization and punctuation: Correct the sentence below: Rewrite the sentence correctly. Read to the student: Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a period (.). the bird splashed in the bathParts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. A proper noun is the name of a particular person place or thing. Play the grammar game below by making up a proper noun for the common nouns below: Play the grammar game. Read the following words aloud to your student and have them tell a proper noun to fill in each blank space. (bird boygirl myself RobinPPPP Grammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounP

Lesson 6C©2023 Classical School Solutions116Phonics PracticemadeRead to the student: Read all of the words on the list. Then add and E to the end of each word and draw the arrow from the “Silent E” to the vowel that will say its name. Then read all of the words again. See the example below. The word mad becomes made.Review “Silent E”Daily Dictation: Phonograms of the day: Y /y/ /i/ /I/ /E/, E /e/ /E/, QU /kw/, TH /th/ /TH/ Sentence of the day: My hat has a big rip.madhatnotripbitkitcutcaptapratHave the student point to the phonograms and say their sounds.

Lesson 6C©2023 Classical School Solutions117bru\\wa\\\\ed\\eep\\ellbu\\33Read to the student: Use the phonogram sh to make words below. Underline the sh phonogram in each word. Write the words, sound out the words and then match each word with the correct picture.Phonics Practice

Lesson 6C©2023 Classical School Solutions118 HandwritingTrace the letters and then write your own starting on the dot.Trace the th Phonograms and then write your own starting on the dots. Trace the words and the sentence below. Draw fish in the bowl below.

Lesson 6C©2023 Classical School Solutions119GrammarCapitalization and punctuation: Correct and rewrite the sentence below. Read to the student: Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a Parts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. A proper noun is the name of a particular person place or thing. Play the grammar game below by making up a proper noun for the common nouns below: Play the grammar game. Read the following words aloud to your student and have them tell a proper noun to fill in each blank space. (fish Pman Pstore Pboy BillP i like bill and timGrammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounP

Lesson 6D©2023 Classical School Solutions120Phonics PracticeShep the sheep takes a bath to wash his feet.Reading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbake3Daily Dictation: Phonograms of the day: AR /ar/, CK /k/ the 2 letter /k/, G /g/ /j/, O /o/ /O/ /oo/ /u/ Sentence of the day: Jan sat in the hot bath.Have the student point to the phonograms and say their sounds.Read to the student: Using red and blue crayons, color the phonograms in the words below. Color the vowel pair phonograms red and all other phonograms blue. Use your phonogram tiles above to check your work. The first two have been completed for you as an example.

Lesson 6D©2023 Classical School Solutions121Read to the student: Can you help Dash the fish swim through all the bubbles? Read all of the sh phonogram words to help Dash. Have the student point to each bubble and sound out each word. Have the student do this for all bubbles on the path. Gather a dark blue crayon. Then, say to the student: Now let’s read the path again but this time we will underline the sh phonogram. dishbashfishwish sashcrashshedshellshiftshiprushgushPhonics Practice

Lesson 6D©2023 Classical School Solutions122 HandwritingTrace the letters and then write your own starting on the dot.Trace the ee Phonograms and then write your own starting on the dots. Trace the sentence below. Draw the curly wool on the sheep.

Lesson 6D©2023 Classical School Solutions123Picture StudyRead to the student: Let’s explore this picture. What are the children doing? Have you ever had a picnic? What kind of fruit tree are the children sitting under? Find a teddy bear. Find a cake. Find a jar of honey. What season do you think it is? Why do you think so? What do you think the children’s names are?

Lesson 6D©2023 Classical School Solutions124Grammarthe cat ran awayParts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Find three nouns in the picture study on the previous page. Draw or place a triangle on the nouns in the picture. Capitalization and punctuation: Correct and rewrite the sentence below. Read to the student: Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a Grammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounP

TEACHER’S NOTESLesson 7A, 7B, 7C, 7D©2023 Classical School Solutions125Phonograms we are working on this week: AR Handwriting: Clock Letters Nursery Rhyme: “Twinkle, Twinkle Little Star” by Jane Taylor Barb and Carl Reader•Dry Erase Boards"•Letter Tiles"•Plastic Sheet Protectors"Readers In Rhyme Teal Set 21-30"• 27. Barb and Carl"Letter Tiles • Guide students to sound out their phonogram tiles to build words from the lesson. You can do this as a class (guided) to begin with and slowly move it to independent work. Dry Erase Board activities •Guide students to sound out and write words from each lesson onto their dry erase board. You can do this as a class (guided) to begin with and slowly move it to independent work. Plastic Sheet Protector activities •Use plastic sheet protectors to create dry erase sheets for students to copy words . You can place phonogram sheets from the lesson in the sheet protectors and let the student complete the work this way. Phonics Bingo •Play games of phonics bingo. Dictation-On a separate piece of lined paper •When dictating phonograms make sure to say all the sounds each phonogram makes. When dictating sentences say each word in the sentence slowly allowing students time to sound out and write the words. Once the students have written the complete sentence, say it again slowly allowing students to check their work. You can gradually increase the pace as the students are ready. Read Aloud •We recommend daily read aloud time.. Set aside 15-30 minutes per day for reading and discussion/narration.Materials•The Adventures of Happy Jack Chapters 1-5 by Thornton BurgessRead AloudConsult Reader Guides for helpful vocabulary and comprehension questions.

Lesson 7A©2023 Classical School Solutions126Phonics PracticeRead the sentences below. All phonograms have been underlined for you. The arrows remind you of the “silent e” words.1. The stars will shine in the dark.2. I will make a wish on a star.3. I will take my dog Bart to the park.4. Mark has a scar on his arm from a fall.Reading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeDaily Dictation: Phonograms of the day: Y /y/ /i/ /I/ /E/, QU /kw/, C /c/ /s/, W /w/ Sentence of the day: I did wish upon a star.Have the student point to the phonograms and say their sounds.Reading Warm Up: Have your child point to each phonogram and say the sound. Slys-t-arstarc-arcarar-tartSilentp-ar-tparty-ar-dyardf-ar-mfarmRead to the student: The phonogram ar says /R/ as in “star”. Read the ar words below. First read each sound in the words below, then put them together to read the word. Phonogram ar

Lesson 7A©2023 Classical School Solutions127cartdartartbarnbarkbarbarmyfarmarmcartarjarbarnbarkarkartpartparty4Have the student read the words, circle the word that matches the picture and then write the word.Phonics Practice

Lesson 7A©2023 Classical School Solutions128HandwritingClock Letterscogdasf Clock Letterscogdasf Trace the phonogram ar below and then trace the ar words.Clock Letterscogdasf Clock Letterscogdasf Add animals and fields to complete the farm scene below.Trace the letters and then write your own starting on the dot.

Lesson 7A©2023 Classical School Solutions129GrammarCapitalization and punctuation: Rewrite the sentence correctly. Read to the student: Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a period (.).Parts of Speech: Verbs Read to the student: A verb shows action! For instance in the sentence “I ran to the park.” Ran is the verb because it tells what I did. Play the grammar game. Read the following words aloud to your student and have them tell a verb to go with the noun above it. (The girl The tree A bird A ship sailsGrammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounP i like to fly a kite

Lesson 7B©2023 Classical School Solutions130Read to the student: Add ar to form words below. Read the words out loud as you write them. The first one has been completed for you.Phonics PracticeDaily Dictation: Phonograms of the day: TH /th/ /TH/, X /x/, E /e/ /E/, SH /sh Sentence of the day: It is my ball and bat.y\\dt\\pm\\shsc\\c\\dh\\pp\\tsh\\kHave the student point to the phonograms and say their sounds.Mark the shark had a party with all his fishy pals.

Lesson 7B©2023 Classical School Solutions131fishdropsfeetsnakecageskyteetharkslothdarkgreenflywetyarddrythreepolewaves\\\\\\\\Write an “ee” word.\\\\\\\\\\\\\\\\Choose words from the list that are found in the picture and write them below.Write a “ar” word.Write a “Silent E” word.\\\\\\\\33Write a “sh” word.Study the picture below with the student. Have the student read the list of words and and circle words that that are found in the picture. Reading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbake3Reading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakePhonics Practice

Lesson 7B©2023 Classical School Solutions132PoetryTwinkle, twinkle, little star, How I wonder what you are! Up above the world so high, Like a diamond in the sky. When the blazing sun is gone, When he nothing shines upon, Then you show your little light, Twinkle, twinkle, all the night. Then the traveler in the dark Thanks you for your tiny spark, How could he see where to go, If you did not twinkle so? In the dark blue sky you keep, Often through my curtains peep For you never shut your eye, Till the sun is in the sky. As your bright and tiny spark Lights the traveler in the dark, Though I know not what you are, Twinkle, twinkle, little star. by Jane Taylor Twinkle, Twinkle, Little Star Say the poem together daily and have the students learn by heart for recitation. Recitation Is recommended for the end of the week. Have the students recite the poem chorally and a few students can be selected to present the poem in a small group or individually.

Lesson 7B©2023 Classical School Solutions133 LoreHandwritingClock Letterscogdasf Trace the letters and then write your own starting on the dot. LoreTrace the first line of Twinkle, twinkle, little star below. LoreTrace the moon and stars. Color the picture.

Lesson 7B©2023 Classical School Solutions134GrammararepeepdarkskyTwinkle, twinkle, little star,How I wonder what youWritten Exercise - Dictation: Have your student listen as you read the excerpts below of the poem “Twinkle, Twinkle, Little Star. Have them fill in the missing words from the options below. Gently have your student erase and correct any mistakes. Be sure to spell all the words correctly. 3Up above the world so high,Like a diamond in theIn the dark blue sky you keep,Often through my curtainsAs your bright and tiny sparkLights the traveler in the

Lesson 7C©2023 Classical School Solutions135Phonics PracticeDaily Dictation: Phonograms: U /u/ /U/ /OO, C /c/ /s/, CK /k/ the 2 letter /k/, O /o/ /O/ /oo/ /u/ Sentence of the day: Let us go walk by the trees.Have the student point to the phonograms and say their sounds.Sparky barks to tell me he wants to go for a walk in the park.Read to the student: How many words can you make with the phonogram “ar” using the letters in the box below. You may use a letter more than once.\ar \ar\\ar \ar\\ar \ar\\ar \ar\tnkcbmfd

Lesson 7C©2023 Classical School Solutions136\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\arkcartpartysharkharpsparksPhonics Practice

Lesson 7C©2023 Classical School Solutions137HandwritingClock Letterscogdasf Trace the letters and then write your own starting on the dot. Trace the AR words below. Draw a yard or a park for the dog to play in.

Lesson 7C©2023 Classical School Solutions138GrammarCapitalization and punctuation: Correct and rewrite the sentence below. Read to the student: Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a A fish The man The cat The boy runs i see the sunGrammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounPParts of Speech: Verbs Read to the student: A verb shows action! For instance in the sentence “I ran to the park.” Ran is the verb because it tells what I did. Play the grammar game. Read the following words aloud to your student and have them tell a verb to go with the noun above it. (

Lesson 7D©2023 Classical School Solutions139Phonics PracticeDaily Dictation: Phonograms: AR /ar/, QU /kw/, OR /or/, EE “E double E always says /E/” Sentence of the day: Pam will push the pram.Have the student point to the phonograms and say their sounds.SilentSilentSilentBart will take Barb on a ride in the cart.Reading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeRead to the student: Using red and blue crayons, color the phonograms in the words below. Color the vowel pair phonograms red and all other phonograms blue. Use your phonogram tiles above to check your work. The first two have been completed for you as an example.

Lesson 7D©2023 Classical School Solutions140sharktartdarkjartarartfarbarkstarstartpartbarhardparkbarnarmyRead to the student: Can you help Noah gather all of the animals into the ark? Read all of the AR phonogram words to help Noah. Have the student point to each animal and sound out each word. Gather a dark blue crayon. Then, say to the student: Now let’s read the path again but this time we will underline the AR phonograms. Circle an animal that has an AR name.Phonics Practice

Lesson 7D©2023 Classical School Solutions141 MidlineShort Line Letters Handwriting MidlineShort Line Letters MidlineShort Line Letters Trace the AR phonograms and then trace the sentence below. MidlineShort Line Letters Draw a road for the car to drive on. Color the picture.Trace the letters and then write your own starting on the dot.

Lesson 7D©2023 Classical School Solutions142Picture StudyRead to the student: Let’s explore this picture. Is it day or night? Who is sleeping in this picture? If the sun is asleep at night who is awake at night? What is the sun sleeping on? Find a house? Find a window. Find the stars. What the sun looks like when it’s asleep by Willy Pogany

Lesson 7D©2023 Classical School Solutions143Grammarthe sun was asleepParts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Find three nouns in the picture study on the previous page. Draw or place a triangle on the nouns in the picture. Capitalization and punctuation: Correct and rewrite the sentence below. Read to the student: Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a Grammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounP

TEACHER’S NOTESLesson 8A, 8B, 8C, 8D©2023 Classical School Solutions144Phonograms we are working on this week: CK Handwriting: Short Line Letters Nursery Rhyme: “Hickory Dickory Dock” Popular English Nursery Rhyme Lucky Duck Reader•Dry Erase Boards"•Letter Tiles"•Plastic Sheet Protectors"Readers In Rhyme Teal Set 21-30"• 28. Lucky Duck"Letter Tiles • Guide students to sound out their phonogram tiles to build words from the lesson. You can do this as a class (guided) to begin with and slowly move it to independent work. Dry Erase Board activities •Guide students to sound out and write words from each lesson onto their dry erase board. You can do this as a class (guided) to begin with and slowly move it to independent work. Plastic Sheet Protector activities •Use plastic sheet protectors to create dry erase sheets for students to copy words . You can place phonogram sheets from the lesson in the sheet protectors and let the student complete the work this way. Phonics Bingo •Play games of phonics bingo. Dictation-On a separate piece of lined paper •When dictating phonograms make sure to say all the sounds each phonogram makes. When dictating sentences say each word in the sentence slowly allowing students time to sound out and write the words. Once the students have written the complete sentence, say it again slowly allowing students to check their work. You can gradually increase the pace as the students are ready. Read Aloud •We recommend daily read aloud time.. Set aside 15-30 minutes per day for reading and discussion/narration.Materials•The Adventures of Happy Jack Chapters 6-11 by Thornton BurgessRead AloudConsult Reader Guides for helpful vocabulary and comprehension questions.

Lesson 8A©2023 Classical School Solutions145Read the sentences below. All phonograms have been underlined for you. The arrows remind you of the “silent e” words.1. The duck will swim back to land.2. I see a pack of sheep on the hill.3. I will find rocks on the path.4. My socks got wet in the pond.Phonics PracticeDaily Dictation: Phonograms of the day: SH /sh/, QU /kw/, U /u/ /U/ /OO/, O /o/ /O/ /oo/ /u/ Sentence of the day: The dog and cat sat on the mat.Have the student point to the phonograms and say their sounds.Read to the student: The phonogram ck says /k/ 2-letter /k/ as in “duck”. “CK” is used only after a single vowel that says it’s first sound /a/ /e/ i/ /o/ /u/. Read the ck words below. First read each sound in the word, then blend them together to read the whole word. Phonogram ckReading Warm Up: Have your child point to each phonogram and say the sound. d-u-ckduckl-u-cklucks-o-cksockn-e-ckneckp-e-ckpeckk-i-ckkick

Lesson 8A©2023 Classical School Solutions146Have the student read the words, circle the word that matches the picture and then write the tocksocklocksackbackstacktrickstickbrickluckstuckducklockticktockrocksocklock4Phonics Practice

Lesson 8A©2023 Classical School Solutions147Handwriting Jack be nimble coloringMidlineShort Line Letters Jack be nimble coloringMidlineShort Line Letters Trace the letters and then write your own starting on the dot. Jack be nimble coloringMidlineShort Line Letters Color the picture of Jack jumping over the candlestick.

Lesson 8A©2023 Classical School Solutions148GrammarCapitalization and punctuation: Rewrite the sentence correctly. Read to the student: Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a period (.).Parts of Speech: Verbs Read to the student: A verb shows action! For instance in the sentence “I ran to the park.” Ran is the verb because it tells what I did. Play the grammar game. Read the following words aloud to your student and have them tell a verb to go with the noun above it. (The boys Joe The dogA ship sailsGrammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounPdan is a big kid

Lesson 8B©2023 Classical School Solutions149Phonics PracticeDaily Dictation: Phonograms of the day: TH /th/ /TH/, QU /kw/, A /a/ /A/ /ah, AR /ar/ Sentence of the day: The queen is not far.Have the student point to the phonograms and say their sounds.Read to the student: Write the phonogram “ck” on the lines below and read the words out loudflo\\pe\\pi\\lo\\do\\lu\\si\\pa\\clo\\bla\\Tick tock went the clock.

Lesson 8B©2023 Classical School Solutions150kickJackfeetsocksjarsharenoseblacklampdoggreenbeesnackflamecryjump\\\\\\\\Write an “ee” word.\\\\\\\\\\\\\\\\Write a “ck” word.Write a “Silent E” word.\\\\\\\\Write a “mp” blend word.3Reading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeStudy the picture below with the student. Have the student read the list of words and and circle words that that are found in the picture.“Jack be nimble, Jack be quick, Jack jump over the candlestick.”Phonics Practice

Lesson 8B©2023 Classical School Solutions151PoetryHickory, dickory, dock, The mouse ran up the clock; The clock struck one, And down he run, Hickory, dickory, dock. Mother Goose Hickory, Dickory, DockOral Exercise — Where did the mouse run? What time did the clock strike? Underline all CK phonograms in each word. How many lines are in the poem?Say the poem together daily and have the students learn by heart for recitation. Recitation Is recommended for the end of the week. Have the students recite the poem chorally and a few students can be selected to present the poem in a small group or individually.

Lesson 8B©2023 Classical School Solutions152 grandfather clockHandwriting Jack be nimble coloringMidlineShort Line Letters Trace the letters and then write your own starting on the dot. grandfather clockTrace the words below.Draw a little mouse running up the clock.

Lesson 8B©2023 Classical School Solutions153Hickory, dickory, ,The mouse ran up the ,The clock one,And down he .Hickory, dickory, ,GrammarstruckrunclockdockWritten Exercise - Dictation: Have your student listen as you read the excerpts below of the poem “Hickory, Dickory, Dock”. Have them fill in the missing words from the options below. Gently have your student erase and correct any mistakes. Be sure to spell all the words correctly.

Lesson 8C©2023 Classical School Solutions154Phonics PracticeDaily Dictation: Phonograms: CK /k/ the 2 letter /k/, AR /ar/, A /a/ /A/ /ah/, CK /k/ the 2 letter /k/ Sentence of the day: Do not go far to see me.Have the student point to the phonograms and say their sounds.Read to the student: How many words can you make using the letters in the box below. You may use a letter more than once.slpd\ack\eck\ick\ock\uck\ick\ack\ockQuack, quack went the wee duck.

Lesson 8C©2023 Classical School Solutions155\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\sicklickclockkickneckblackRead to the student: Copy the words on the lines below. Underline the ck phonogram in each word and then match each word with the correct picture.123111572104896123111572104896123111572104896123111572104896123111572104896123111572104896Phonics Practice

Lesson 8C©2023 Classical School Solutions156Handwriting Jack be nimble coloringMidlineShort Line Letters Trace the letters and then write your own starting on the dot. Trace the sentence below. Draw a pond for the ducks to swim in. Color the picture.

Lesson 8C©2023 Classical School Solutions157GrammarCapitalization and punctuation: Rewrite the sentence correctly. Read to the student: Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a period (.).Parts of Speech: Verbs Read to the student: A verb shows action! For instance in the sentence “I ran to the park.” Ran is the verb because it tells what I did. Play the grammar game. Read the following words aloud to your student and have them tell a verb to go with the noun above it. (The fish A shark A flowerA cat sailsGrammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounPthe duck walks fast

Lesson 8D©2023 Classical School Solutions158Jack will take a bath with his duck Quack.Phonics PracticeDaily Dictation: Phonograms of the day: Y /y/ /i/ /I/ /E, QU /kw/, M /m/, U /u/ /U/ /OO/ Sentence of the day: See the wet dog in the park.Have the student point to the phonograms and say their sounds.Read to the student: Using red and blue crayons, color the phonograms in the words below. Color the vowel pair phonograms red and all other phonograms blue. Use your phonogram tiles above to check your work. The first two have been completed for you as an example.

Lesson 8D©2023 Classical School Solutions159pickducklicktickpackneckbacksackluckstickluckslacktuckRead to the student: Can you read the CK words on all the ducks in the pond? Read all of the CK phonogram words on the trail of ducks. Have the student point to each duck and sound out each word. Gather a dark blue crayon. Then, say to the student: Now let’s read the path again but this time we will underline the CK phonograms.Phonics Practice

Lesson 8D©2023 Classical School Solutions160Handwriting Dash Line Letters Dash Forward Dash Line Letters Dash ForwardTrace the letters and then write your own starting on the dot. Dash Line Letters Dash ForwardTrace the sentence below. Dash Line Letters Dash Forward Dash Line Letters Dash ForwardTrace and color the ducks below.

Lesson 8D©2023 Classical School Solutions161Picture StudyRead to the student: Let’s explore this picture. Is it day or night? What is happening in the picture? What kind of animals are in the water? What kind of animals are crossing the bridge? Does it seem to be a windy day or a calm day? Why do you think so? What do you think the farmer boy’s name is?

Lesson 8D©2023 Classical School Solutions162Grammarthe dog likes sticksParts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Find three nouns in the picture study on the previous page. Draw or place a triangle on the nouns in the picture. Capitalization and punctuation: Correct and rewrite the sentence below. Read to the student: Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a Grammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounP

TEACHER’S NOTESLesson 9A, 9B, 9C, 9D©2023 Classical School Solutions163Phonograms we are working on this week: OR, Silent E #2 Handwriting: Top Line Letters Nursery Rhyme: “Little Boy Blue” Popular English Nursery Rhyme Hobby Horse Reader•Dry Erase Boards"•Letter Tiles"•Plastic Sheet Protectors"Readers In Rhyme Teal Set 21-30"• 29. Hobby Horse"Letter Tiles • Guide students to sound out their phonogram tiles to build words from the lesson. You can do this as a class (guided) to begin with and slowly move it to independent work. Dry Erase Board activities •Guide students to sound out and write words from each lesson onto their dry erase board. You can do this as a class (guided) to begin with and slowly move it to independent work. Plastic Sheet Protector activities •Use plastic sheet protectors to create dry erase sheets for students to copy words . You can place phonogram sheets from the lesson in the sheet protectors and let the student complete the work this way. Phonics Bingo •Play games of phonics bingo. Dictation-On a separate piece of lined paper •When dictating phonograms make sure to say all the sounds each phonogram makes. When dictating sentences say each word in the sentence slowly allowing students time to sound out and write the words. Once the students have written the complete sentence, say it again slowly allowing students to check their work. You can gradually increase the pace as the students are ready. Read Aloud •We recommend daily read aloud time.. Set aside 15-30 minutes per day for reading and discussion/narration.Materials•The Adventures of Happy Jack Chapters 12-17 by Thornton BurgessRead AloudConsult Reader Guides for helpful vocabulary and comprehension questions.

Lesson 9A©2023 Classical School Solutions1641. Ben is a sports fan.2. Corn on the cob is sweet.3. I ride my horse in the park.4. I see a storm to the north of us.Reading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakePhonics PracticeDaily Dictation: Phonograms of the day: O /o/ /O/ /oo/ /u/, AR /ar, SH /sh/, S /s/ /z/ Sentence of the day: Jan and Jet ran so fast.Have the student point to the phonograms and say their sounds.Read the sentences below. All phonograms have been underlined for you. The arrows remind you of the “silent e” words.h-or-s-ehorseh-or-nhornt-or-ntornb-or-nbornf-or-kforkp-or-kporkReading Warm Up: Have your child point to each phonogram and say the sound. Read to the student: The phonogram or says /or/ as in “fork”. Read the or words below. First read each sound in the word, then blend them together to read the whole word. Phonogram or

Lesson 9A©2023 Classical School Solutions165corncrustcordfishforkformstickstuckstorkfortfanfliphunthathornforkcorkstorkHave the student read the words, circle the word that matches the picture and then write the word.Phonics Practice

Lesson 9A©2023 Classical School Solutions166Top Line Letters ltbhk Top Line Letters ltbhk HandwritingTrace the letters and then write your own starting on the dot.Top Line Letters ltbhk Top line letters start at the top line and go down to the baseline.Trace the OR phonograms below.Top Line Letters ltbhk Finish drawing the rails for the rocking horse below. Color the picture.

Lesson 9A©2023 Classical School Solutions167GrammarCapitalization and punctuation: Rewrite the sentence correctly. Read to the student: Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a period (.).Parts of Speech: Verbs Read to the student: A verb shows action! For instance in the sentence “I ran to the park.” Ran is the verb because it tells what I did. A noun is a person, place or thing. Play the grammar game. Have your student complete the sentence below using the appropriate parts of speech. Grammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounPthe horse has socksI to the

Lesson 9B©2023 Classical School Solutions168g-l-u-eglueb-l-u-eblueh-a-v-ehavel-o-v-eloveRead to the student: “Silent E” has many jobs. We have already learned that in words with a consonant/vowel/consonant/e pattern, the E is silent and makes the vowel before it say its name. Today we will learn about “Silent E’s” job #2. English words do not end in a V or U so “Silent E” sits at the end of these words. Silent E (Job #2)Slyc-u-b-ecubet-u-b-etuber-u-d-erudem-u-t-emutef-u-s-efusec-u-t-ecuteSilentSilent1. I see the sun in a blue sky.2. I live on a farm.3. I have a horse on my farm.4. My wife is my true love.Read the sentences below. All phonograms and “Silent E” words have been marked for you.Reading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakePhonics PracticeHave the student point to the phonograms and say their sounds.Daily Dictation: Phonograms of the day: S /s/ /z/, AR /ar/, A /a/ /A/ /ah/, Y /y/ /i/ /I/ /E/ Sentence of the day: Do not go fast or far.

Lesson 9B©2023 Classical School Solutions169\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\gluelovecluearguesleeveblueRead to the student: Copy the words on the lines below. Match each word with the correct picture.Phonics Practice

Lesson 9B©2023 Classical School Solutions170PoetryLittle boy blue, Come blow your horn, The sheep's in the meadow, The cow's in the corn. But where is the boy Who looks after the sheep? He's under a haystack, Fast asleep. Mother Goose Little Boy BlueOral Exercise —Where do you think little boy blue is? Why do you think he needs to blow his horn? Where are the sheep? Where are the cows? Underline the words that have the phonogram “or” in them. How many lines are in the poem?Say the poem together daily and have the students learn by heart for recitation. Recitation Is recommended for the end of the week. Have the students recite the poem chorally and a few students can be selected to present the poem in a small group or individually.

Lesson 9B©2023 Classical School Solutions171Handwriting Trace the letters and then write your own starting on the dot.Top Line Letters ltbhk Top line letters start at the top line and go down to the baseline.Trace the “Silent E” and OR words below.Draw thew haystack that little boy blue fell asleep under. Color the picture.

Lesson 9B©2023 Classical School Solutions172GrammarasleepbluecornsheephornLittle boy ,Come blow your ,The sheep's in the meadow,The cow's in the .But where is the boyWho looks after the ?He's under a haystack,Fast .Written Exercise - Dictation: Have your student listen as you read the excerpts below of the poem “Little Boy Blue”. Have them fill in the missing words from the options below. Gently have your student erase and correct any mistakes. Be sure to spell all the words correctly.

Lesson 9C©2023 Classical School Solutions173Phonics PracticeDaily Dictation: Phonograms: EE “E double E always says /E/”, G /g/ /j/, E /e/ /E/, SH /sh/ Sentence of the day: The barn is so cold.Have the student point to the phonograms and say their sounds.Read to the student: How many words can you make with the letters or phonograms in the boxes below? Hint: match the same colors to make words.for\\\\ornfor\\\\ort\\orn\\orn\\ortfor\\\\orn\\ortmkcwshtspthh

Lesson 9C©2023 Classical School Solutions174kickhomefeettreeshorsesharenoseblackwallneckgreenhornsnackrideskyjump\\\\\\\\Write an “ee” word.\\\\\\\\\\\\\\\\Choose words from the list that are found in the picture and write them below.Write an “or” word.Write a “Silent E” word.\\\\\\\\Write a “ck” blend word.3Reading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeReading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbakeStudy the picture below with the student. Have the student read the list of words and and circle words that that are found in the picture.Phonics Practice

Lesson 9C©2023 Classical School Solutions175Handwriting Slant Stroke Letters: Slant down from the midline Slant line letters slant down from the midline. Slant Stroke Letters: Slant down from the midline Trace the letters and then write your own starting on the dot. Slant Stroke Letters: Slant down from the midline Slant Stroke Letters: Slant down from the midline Oh no! The cow and buffalo are missing their horns. Draw their horns and color the picture.

Lesson 9C©2023 Classical School Solutions176GrammarCapitalization and punctuation: Rewrite the sentence correctly. Read to the student: Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a period (.).Parts of Speech: Verbs Read to the student: A verb shows action! For instance in the sentence “I ran to the park.” Ran is the verb because it tells what I did. A noun is a person, place or thing. Play the grammar game. Have your student complete the sentence below using the appropriate parts of speech. Grammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounPthe bull has hornsFord across the

Lesson 9D©2023 Classical School Solutions177Jack the stork wore a hat and a scarf in the cold storm.Phonics PracticeDaily Dictation: Phonograms of the day: SH /sh/, QU /kw/, O /o/ /O/ /oo/ /u, TH /th/ /TH/ Sentence of the day: The fish flips and flops.Have the student point to the phonograms and say their sounds.Read to the student: Using red and blue crayons, color the phonograms in the words below. Color the vowel pair phonograms red and all other phonograms blue. Use your phonogram tiles above to check your work. The first two have been completed for you as an example.

Lesson 9D©2023 Classical School Solutions178cornhornsortportstormstorkshortnorthdormcordforkfortRead to the student: Porky Pete loves popcorn. Help Porky get all the popcorn by following the popcorn trail and reading the or words. Have the student point to each box of popcorn and sound out each word. Gather a dark blue crayon. Then, say to the student: Now let’s read the path again but this time we will underline the OR phonograms.Phonics Practice

Lesson 9D©2023 Classical School Solutions179 Handwriting Trace the numbers and then write your own starting on the dot.Trace the OR phonograms below. Write two or words on the line below. Draw something for the horse to jump over. Color the picture.

Lesson 9D©2023 Classical School Solutions180Picture StudyRead to the student: Let’s explore this picture. Is it day or night? What is happening in the picture? How many animals are in the picture? What is the little boy doing? Does it seem to be a windy day or a calm day? Why do you think so? Where do you think the lady is going? Find a feather. Find three flowers. Find two hats.

Lesson 9D©2023 Classical School Solutions181Grammari have a red hatParts of Speech: Nouns Read to the student: A noun is the name of a person, place or thing. Find three nouns in the picture study on the previous page. Draw or place a triangle on the nouns in the picture. Capitalization and punctuation: Correct and rewrite the sentence below. Read to the student: Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a Grammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounP

TEACHER’S NOTESLesson 10A, 10B, 10C, 10D©2023 Classical School Solutions182Phonograms we are working on this week: OO Handwriting: Clock Letters Nursery Rhyme: “Hey Diddle Diddle” Popular English Nursery Rhyme By the Brook Reader•Dry Erase Boards"•Letter Tiles"•Plastic Sheet Protectors"Readers In Rhyme Teal Set 21-30"• 30. By the Brook"Letter Tiles • Guide students to sound out their phonogram tiles to build words from the lesson. You can do this as a class (guided) to begin with and slowly move it to independent work. Dry Erase Board activities •Guide students to sound out and write words from each lesson onto their dry erase board. You can do this as a class (guided) to begin with and slowly move it to independent work. Plastic Sheet Protector activities •Use plastic sheet protectors to create dry erase sheets for students to copy words . You can place phonogram sheets from the lesson in the sheet protectors and let the student complete the work this way. Phonics Bingo •Play games of phonics bingo. Dictation-On a separate piece of lined paper •When dictating phonograms make sure to say all the sounds each phonogram makes. When dictating sentences say each word in the sentence slowly allowing students time to sound out and write the words. Once the students have written the complete sentence, say it again slowly allowing students to check their work. You can gradually increase the pace as the students are ready. Read Aloud •We recommend daily read aloud time.. Set aside 15-30 minutes per day for reading and discussion/narration.Materials•The Adventures of Happy Jack Chapters 18-23 by Thornton BurgessRead AloudConsult Reader Guides for helpful vocabulary and comprehension questions.

Lesson 10A©2023 Classical School Solutions183Phonogram ooPhonics PracticePhonograms of the day: U /u/ /U/ /OO, M /m/, AR /ar/, OR /or/ Sentence of the day: Bill fell on the hill.Have the student point to the phonograms and say their sounds.Read to the student: The letters OO can make two different sounds as in the GOOSE is GOOD. The most common sound of OO is /oo/ as in FOOD. First read each sound in the pictures below, then put them together to read the word. Then read the sentences. 2 2 2 2g-oo-s-egoosez-oo-mzoomf-oo-dfoodt-oo-ltoolg-oo-dgoodw-oo-dwoodh-oo-dhoods-t-oo-dstoofReading Warm Up: Have your child point to each phonogram and say the sound. 2 2 2 2g-oo-s-egoosez-oo-mzoomf-oo-dfoodt-oo-ltoolg-oo-dgoodw-oo-dwoodh-oo-dhoods-t-oo-dstoofReading Warm Up: Have your child point to each phonogram and say the sound. 1 /oo/2 /OO/

Lesson 10A©2023 Classical School Solutions184r mh km sebr mst lRead to the student: Read the sentences below. All phonograms have been underlined for you. The arrows remind you of the “silent e” words.1. I see the moon in the sky.2. We will have a pool party next week.3. I will use the broom to sweep the room.4. I lost a baby tooth at noon.3Reading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbake4f tb tw dg dl pOh no! The goose is on the loose!Read to the student: Add OO to make words below. Remember the sounds of /oo/ /OO/. Read the words out loud as you write.2222Phonics Practice

Lesson 10A©2023 Classical School Solutions185Handwriting Trace the letters and then write your own starting on the dot.Clock letters start at 2 o'clock and go around the clock. cogdasf Draw a hat on the silly goose.

Lesson 10A©2023 Classical School Solutions186GrammarCapitalization and punctuation: Rewrite the sentence correctly. Read to the student: Capitalize the first letter of the first word in a sentence. Always capitalize a person’s name. End a sentence that is a statement or tells something with a period (.).Parts of Speech: Verbs Read to the student: A verb shows action! For instance in the sentence “I ran to the park.” Ran is the verb because it tells what I did. A noun is a person, place or thing. Play the grammar game. Have your student complete the sentence below using the appropriate parts of speech. Grammar Symbols: May be found to cut out in your google classroom. Noun VerbPersonalNounPthe bear has a red hatJanher bike.Nan walks to the

Lesson 10B©2023 Classical School Solutions187Phonics PracticePhonograms of the day: U /u/ /U/ /OO/, QU /kw/, M /m/, TH /th/ /TH/ Sentence of the day: Bill is sad he got a scab.Have the student point to the phonograms and say their sounds.How many words can you make with the phonogram “OO” using the letters in the boxes below.\oo\ \oo\\oo\ \oo\\oo\ \oo\\oo\ \oo\Brook likes to cook food for the family.Reading Warm Up: Have your child point to each phonogram and say the sound. c-a-k-ecakeg-a-m-egamec-a-v-ecaves-a-f-esafev-i-n-evinel-i-f-elifef-i-n-efinew-i-p-ewipeJbake22tlkcbn

Lesson 10B©2023 Classical School Solutions188goodgiftgoosefoodforkfootbooksbootsbooboombroombloomsoonsootspoonmilkmoosemoonHave the student read the words, circle the word that matches the picture and then write the word.2222Phonics Practice

Lesson 10B©2023 Classical School Solutions189PoetryHey, diddle, diddle! The cat and the fiddle, The cow jumped over the moon; The little dog laughed To see such sport, And the dish ran away with the spoon. Mother Goose The Cat and the FiddleOral Exercise — Where do you think the dish and the spoon are going? Underline the words that have the phonogram “oo” in them.Say the poem together daily and have the students learn by heart for recitation. Recitation Is recommended for the end of the week. Have the students recite the poem chorally and a few students can be selected to present the poem in a small group or individually.

Lesson 10B©2023 Classical School Solutions190 HandwritingTrace the letters and then write your own starting on the dot.Clock letters start at 2 o'clock and go around the clock. cogdasf Trace the OO phonograms and then trace the sentence below. Color the picture.

Lesson 10B©2023 Classical School Solutions191Grammarspoondishmoonsport Hey, diddle, diddle! The cat and the fiddle,The cow jumped over the ;  The little dog laughed To see such ,And the ran away with the .Written Exercise - Dictation: Have your student listen as you read the excerpts below of the poem “Little Boy Blue”. Have them fill in the missing words from the options below. Gently have your student erase and correct any mistakes. Be sure to spell all the words correctly.

Lesson 10C©2023 Classical School Solutions192Phonics PracticePhonograms of the day: EE “E double E always says /E/”, S /s/ /z/, QU /kw/, O /o/ /O/ /oo/ /u/ Sentence of the day: Jill can hop and skip.Have the student point to the phonograms and say their sounds.1. moon2. foot3. mood4. good5. wood6. pool7. booth8. took9. look10. roomOO’s 1st sound /oo/\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\OO’s 2nd sound /OO/Dictate the list of words to the student one at a time. Have the student write each word in the proper column according to the sound of OO that the word uses. The first one has been completed as an example.moon

Lesson 10C©2023 Classical School Solutions193s\\\dsb\\\tssp\\\nd\\\rb\\\br\\\mRead to the student: Use the phonogram ee or oo to make words below. Underline the phonogram in each word. Write the words, sound out the words and then match each word with the correct picture.goodgiftgoosefoodforkfootbooksbootsbooboombroombloomsoonsootspoonmilkmoosemoongoodgiftgoosefoodforkfootbooksbootsbooboombroombloomsoonsootspoonmilkmoosemoongoodgiftgoosefoodforkfootbooksbootsbooboombroombloomsoonsootspoonmilkmoosemoonPhonics Practice

Lesson 10C©2023 Classical School Solutions194 cogdasfHandwritingTrace the letters and then write your own starting on the dot.Clock line letters start at 2 o'clock and go around the clock. cogdasf Draw clouds around Mother Goose.

The Readers In Rhyme full Level 1 program includes 20 comprehensive lessons spanning 390 pages, designed to engage young learners with content rooted in classical education principles. Level 1 also comes with 20 readers (Teal 21-30, Olive 31-40) to reinforce the concepts taught. For physical samples, please contact Rebecca Shivone at rebecca.shivone@classicalteachers.com