Return to flip book view

SUPPLIED WITH Photos CD artwork Event Details copy ADDITIONAL PIECES ASSOCIATED BUT NOT PICTURED Posters Web ready artwork Flyers CLIENT Faith Events Live PROJECT Kathy Troccoli CD Release Event SCOPE OF WORK Create Artwork for use as an invitation to a CD release event for Grammy nominated Kathy Troccoli Photo manipulation Ad Poster Flyer Layout Design Files readied for print web based advertising

CLIENT House Of Blues PROJECT Rockstar Karaoke SCOPE OF WORK Create Artwork for use with the HOB Rockstar Karaoke Weekly event Created Event logo as well as wrote the copy Photo manipulation Ad Poster Flyer Layout Design Files readied for print Job specced and sent to printer SUPPLIED WITH House Of Blues Logo Event Details ADDITIONAL PIECES ASSOCIATED BUT NOT PICTURED Posters Web ready artwork Flyers

CLIENT Carl Granieri Orchestras PROJECT New Repeat Business Postcard Company Branding SCOPE OF WORK Create a brand look and feel for the premier orchestra and black tie musical entertainment brokers in South Jersey Photo manipulation Collateral Layout Design Files readied for print Job specced and sent to printer SUPPLIED WITH Original Photography and limited copy points and various event details ADDITIONAL PIECES ASSOCIATED BUT NOT PICTURED Logos Business Cards Event Posters Web ready artwork Playbills Event Tickets Brochures Vehicle Magnets Banners Signage

CLIENT Caesars Atlantic City PROJECT Harley Davidson Giveaway SCOPE OF WORK Create Artwork for use with the Caesars Atlantic City s Harley Davidson Giveaway All artwork was created from scratch Studs and leather were created specifically for this job Photo manipulation Ad Poster Flyer Layout Design Files readied for print Job specced and sent to printer SUPPLIED WITH Caesars Logo Event Details ADDITIONAL PIECES ASSOCIATED BUT NOT PICTURED Custom Envelope Posters Web ready artwork Flyers Event Tickets Billboards On and Offsite signage

CLIENT Caesars Atlantic City PROJECT Corvette Giveaway SCOPE OF WORK Create Artwork for use with the Caesars Atlantic City s Corvette Giveaway Job contains Blind Spot UV coating Foil Photo manipulation Ad Poster Flyer Layout Design Files readied for print Job specced and sent to printer including specialty printing breakdowns SUPPLIED WITH Caesars Logo Event Details ADDITIONAL PIECES ASSOCIATED BUT NOT PICTURED Custom Envelope Posters Web ready artwork Flyers Event Tickets Billboards On and Offsite signage

CLIENT Bally sAtlantic City PROJECT Fifties Slot Tourney SCOPE OF WORK Create Artwork for use with the Bally s Atlantic City s Fifties Slot Torney Job contains Blind Spot UV coating Foil Photo manipulation Ad Poster Flyer Layout Design Files readied for print Job specced and sent to printer including specialty printing breakdowns SUPPLIED WITH Bally s Logo Event Details ADDITIONAL PIECES ASSOCIATED BUT NOT PICTURED Custom Envelope Posters Web ready artwork Flyers Event Tickets On and Offsite signage Billboards

CLIENT Caesars Atlantic City PROJECT Lincoln Tunnel Billboard SCOPE OF WORK Create Artwork for brand promotional use for Caesars Atlantic City including copy concept Photo manipulation Billboard Layout Design Files readied for print Job specced and sent to printer SUPPLIED WITH Caesars Logo

CLIENT Harrah s Entertainment Total Rewards Multi property PROJECT Total Express Shuttle SCOPE OF WORK Create Artwork for brand promotional use for Harrah s Entertainment Total Express Shuttle service Developed copy concept of Routes being the suits Created Logo then applied to Buswraps and signage Photo manipulation Billboard Layout Design Files readied for print Job specced and sent to printer SUPPLIED WITH Total Rewards Cards details

CLIENT Anj PROJECT When Grey Blushes CD design SCOPE OF WORK Create Artwork for CD design for local musician Photo manipulation CD layout Design Files readied for print Job specced and sent to printer Printer consult SUPPLIED WITH Original untouched photography ADDITIONAL PIECES ASSOCIATED BUT NOT PICTURED Posters Web ready artwork Flyers Event Tickets Myspace layouts Stickers Event leave behinds

CLIENT Bally sAtlantic City PROJECT Chicago themed New Year s Eve Invitation SCOPE OF WORK Create Artwork for use with Bally s Atlantic City s Chicago themed New Year s Eve Event Job was printed 4color Process on Rainbow Mirror holographic Stock to give the effect of movement Invitation was then inserted into a plastic sleeve to further enhance the effect Job contains Blind Spot UV coating Foil Tivoli lights and all artwork were created specifically for this job Photo manipulation Ad Poster Flyer Layout Design Files readied for print Job specced and sent to printer including specialty printing breakdowns Printer consultations SUPPLIED WITH Bally s Logo Event Details Limited copy ADDITIONAL PIECES ASSOCIATED BUT NOT PICTURED Custom Envelope Posters Web ready artwork Flyers Event Tickets Billboards On and Offsite signage Event collateral including Turndown letters Photo frames seating cards etc

CLIENT Anj PROJECT Casual World Intimate Heart Postcard SCOPE OF WORK Create Artwork to reflect the themes of a one woman stage show put on during the Philly Fringe Festival Photo manipulation Postcard Layout Design Files readied for print Job specced and sent to printer SUPPLIED WITH Original Photograph and Philly Fringe logo details and copy ADDITIONAL PIECES ASSOCIATED BUT NOT PICTURED Posters Web ready artwork Playbills Event Tickets

i n f o j e s t JOB GDS3 001 ergraphix net 6 0G9A M4 0I2N G1 2D0 E7 L IV1E0R7 YI RSOYQSUTOEIMS SD COLOR R GAL OPTION 1 L O WAY N J 08205

1

HTOohneRoSrDiSgmoEcaiReZtyeO taTFhCehOappuMtreproEosfeGOofrAdOerrdeorf Omega is of Omega a National is Greek IiNatTitoSetsaP iRInREteoECdoOEatGNhNCheIriOgZsUhEtRosAtsthGatornEisdveteahrfefdormraotsfetiomrlneicailtaodyrnectrmisonhenuinspepiaiacnnluodionnugtwsetroahfmtritaseatnielnirnmnweie thynaotna dchtaitvvo e omTftooeTumromBtguiRoabUtnInueNNriaozIsGlTnaioTEtnqifOotutoenGheurEeestwTstsiihnttHo aisncEunthsRindtoudimwnftegieirlloolmsnfcthrb aasaeenlltfrpedarsarintnnotodegiftrimtyannhntoiemtedlidrfeeachsntcoehaullalpenelntfdgysudi eslaannowtleetruoisommfmsrri eanetintine etsartonnoofidntcytsahrtaeeubfafdaitaneseisnirstsati n To help CREATE an be discussed solutions openly atmosphere where across Greek lines ideas and issues and to help work can out Members semester amnudstcommapinletatein1afu3n 1dGraPiAse rcopmerpsleetmee1ssteerrv ice project per AAInllpptheharafRCrRPOahhOtEieRi RrOWCnhGmiotOeyAAgCaGNNoCuNnoIUc ZIEilNZd ASETIeVrDIvOEicGeRNFRrSSaEtIeATrEnTYiKty Phi Phi Gamma Delta Kappa Psi FIJI Pi Kappa Alpha Sigma Sigma Alpha Pi Epsilon Tau Delta Phi Tau Tau Epsilon Phi Kappa Epsilon TDAAPhellepapltnthhaa aaHPPSEehhilpigilesEAmnipllaiposcnhiAAlaolPspnhshoiaciation Sigma Delta Tau ANlapthioanPahl iPAanlphheallenic Council NPHC OKAmalppehpgaaaKAPalsppihpPaahPiAslpi ha PDheiltBaeStaigSmigamTaheta Zeta Phi Beta Iota Phi Theta ChamGO2blf0eafirs1lcsMaebinuoolrfSloiGtc uaNrdeJHeeink0llt8ARC0fofe2aan8idtresr 215 85865 62 5265 64 2596605 PFhaoxne wwGwre reokwliafen erdouw garne eekdluife PMLCLsLaGuhiaamrSimmSeUbieibgbgdpkmddmasaCaaiaSluToTPilUhgnthhumepeSirtstaaaiaigllUoAmPOnlphrapsgihialaonnizations Council GCOC Alpha Nu Omega Lambda Tau Omega DORttecynioaouwrnrabrasPneenrdnhohtasUalslypvfnoereireocvocetfbriorivetstgeyehintnSeyicz toeuaOWmdofefipvmenaceutrerw nt2oio8touyfflGdGwrtehrlhieeekikeleek RleoteAotwntferfaeaornnilorlcersUogd unawnriavaietezgaretswthiitooyeynuosulUcdwnotmiliovitkhemedrmusisnitetcoiymto ybvwGeeserrrilsenchoeocuikempreoo1f9frryg6aaoapt8uenp rirznotwaiox eiTmattshhnhaeeedrtroevppulmiycergoier7hssm0sotis0ohnoetrnaseolfltu uioagngdfnotheevdnltetlhhtesrsenceo tacuUGniaancrlleeivcse ekukIrirnslilcoistaosyodim tsfdymicsttuoithoun rncdoit ueuyrntgrhthaiscetuabGclRayarroedpweperkamroonvicgcidorUaiamnmncgmhisviuleeeanrvansietdidymteyretsshntihrsrtoiipvautengoosdhpteptcoonoocrmpdtouremuovnrmueiatlngoioeietptsey BE pNtGsmofrerooEeelrvfmeF igtdkLghbaIe oeeielTnaveroedtsaSptremeanelrrenrOispnaadhlgtedFioicpeocrh rngGoosaampohpRnpfitmpieotzEGhurarternEtouesiifoctnekKfiinhkiiectlsalsiesLeprwstsIaehFaarroe fernEorredgerraeecnsssoaistzpmbueaoindmtlniiettoisiintaenitbtlesslslye e svpitemnahymrc eiilleetamuhStsndybeetteeehrscrrvorsoiofGacmporecceifmcooeoummkunrmmmei vGtuieyetrmnmneoietbteusykent PrrtCseshBooaeipeflmrcaacvshnmraiecttuoiruhecsvpnrieioppciptpaoeyroytrouetat joureriennchmitvautsiaiEmeswsassaatici dnnofheodni r osMtTrpthgrhaoeoainssnnctyg ionzmcaeNcsotthymewilsaotluetowpnegnrtsomkeeirtirkyncsoiogantfphngpospr rpouoopeuprvrntgpoiudshvoneirddjitoteGocibeeoorsvsersnesetannukanetdoldcaletfsniitaonteturnstroedsucreawnonnlwisuldttlhiemhstighpntfeiahosin e r nation and world iFnyltervWoroaaRaoaouGrtbotedpocgloPreArvqufetawpelrsferuaeseornnfoeetamedsleaauuikirsanthzsisrtedoscryiauctiennsGetphitonauoU tnwi ro tmonindedtnthnaound iseeomsieeteursv nksistelueOr tdwfocnxsarrn8prfrpoosaotioe5otlvtiremttiotrrykre6kitryssimheriijt ahmioenonyterunenigaite2enomtnsocaniUa5uaeieieGledtnt6rnnsnbiaymrwnid iwdenet vof4beheselgeeofer2veitkrfbrrls eru9iessm tseWssrolloi6ainet hytryettcedAyio tpocRasloleracolormhRiuocrhttomniwiaoropawpketooenwrapauswfgdmfacnt soaoarrewtrbntGfieUnrgwhfr erreienuKaerzUaeorlhisemaeaerwvnmaezdlttkeooviaikixsvorafotinnp lnseonnnitg feirhessytyserscyteod ooRhight timuwuiaGosSyrep rtedaercsgicmaieonrdthnrehiteno eagaovreikoseenunnltodaapksdecglyurvwiplzonsieqnfo iemhlweumnuyori mnvtaiCpthetuaoil honauqintltsovstvonuiieeateoerilieniertdsnmueyvrifbysrniateotaccheotantreeriecaontteoottofoeoochmrowuhfnfharorafiihpmtanezotvharhirlGgfaenli ineednrtagacrineGeoTspetegtron hahakeereteredotkr Sincerely The Office of Greek Affairs SjBtafkibhMorsnccnftroeertkrooooeoetoretmhtmwrfmthshemesmiyebeoSneor oneherhcilogitsiummsdroionmdastrtmioegb enhhlewBideerezaintphtrroie httitiosonfn hoepy toidgfhroingYgfdnaesiuege oovrsn rrerioucendhdasaaadraneudontnttctaoudcaiiwofmnfldahcirruostg taioaeisyeiornsoputs ekmnctentnmnsladireee atssnsrosmtloeoiswhbsrtfnibe ryeuseeeo oBSstyltssrlpfhuraoispoasopiapufsresttboenwphoerhcieeroorrniatseTttllihirmouitihr ntnstoyhshnnlgetgoivhoegeoiftdeeioirfdiabyrnnelsdtooowa gossuo eund alefdsg tysomake new friends GREEK FACTS 44 ofrfaUte Srn Pitryemsiedmenbtesrshhaivpe held 50 CEoOf sthaeretofpra1t0erfnoirttyumneen5 00 Greehkasptpuiedrenthtsanraottehtehrecirolcleogllieagneslife Greekstahraenmoothreerlickoelllyetgoiagnrsaduate FREQUENTLY ASKED QUESTIONS QAgsft o rohaWAaratoltesfhrrrliaaaatnytnstiettdisyrsahnaoaailsrtirfpFyseerioortatiarrhmtoteesireooriir tnnryoesi tfrcwyfitoohyomrortissmSm aoofanrrgkioleryeronicaudtaypscl hlooeimfpdmmaaneiGtndmreokeernnkotwowtoorlmgeeadeangnciehzf oaoTtrtiomohgneeed rtshfboteryrroalntifhgbeeer sorT ethThmehereemhimreobmcoeodbrmesomrrlsesoatinhsrntaeet xrpgfhoreororomiwednaaacnfnerddabtmcueoiarlnmdkisemtyttoihoeners Fraternity alumni their universities tahraenmnoorne sGurpepeokratilvuemtnoi 76 oifnthAemMereicna haWvoembeeneninGWreheok s Who Gcreoemkinmscutuandmiteypnugtssroaaucrpetisvmaitofietreesriancnovdolllevgeed QAab ceDWaindohgeiGmlperaiecmrestek omcfolbauregbGrassr nehoieizrpkgaadtoinorogieznasasntritiezoaqankutseiio rujenopabaasrte ilmfoiantemvocaifollyutmiaammbnlediet m freienntd sG rTehekestiamree mknaonwangefmorebnatlsaknicllisntghtahteairretilmeaernbeedtwfreoemn QArdefe oi igs tPWcmrhQcaJulAaesnufeimrho a nopcsderAsouiWCtrdhFlFnOwieMilCrctnanoioaiiietnloNisltnoglemaalmcsllicmeaovelmgmiaoreoeettdppnredmyedrhllsgplbGmlei ieooeeaoehgganylPteFdreutbemuiiciiiAriebarptzbttcae2sttsGiieideiciol4orctaeplaolemFrdiasinsnsnagctrennsohedyotioitldoebduonmrlorilegfluiiprkmafceiBlossesmirmpngtcrusturaw auysehytade siunmbesnbtt hcSleresoromrreimemstestcseiravct uciwrstnei cciiNbtcdaShtttalthocteniluetatcekmeylpeneashgermnwifcdetadOtlpenneesodldoutsmmrrytiftMmitrzerotmfihlshgscaheabaattheceiaehultatdplaeynaimreindnab irrvv smiceGdrNisoIntobieeuzsntnehrsimfe celeatesGaefcetsirlwGdtosptsheueriPiiwW skrnriouekd oMAvmiegBentliiieolnihrefstdtoooaebehrmokraltefmtkrwbemoaachpioAes2roqpyftbiuipeeahitntfp nugqoe5hfhjlmarlothiouaiornoceorl opiavbiiltersiRnaurnhra einned sngbGeltediIdtpr noTadnlgEsrasterfghonedhifditke tvsuuueeihaess aeaiztcledkudmvrelra afiybGayuereonttnmoitcialrohteoilioirceenloofistoagnuaodsentawcunraslutmnknasObrin uFdnesoetppyooiFdleifgz dopolfiurretnyatromgcnhrlunairpttlienatea sitttr auoqtiolgnolannOtinteurmriofirinditzsfaaitnywrrfideoantssHegFhsciitjtttmustmo caeiehh1niorsnz2aieedaOaopnciitnn nntcfcoahf MrgtfifgdairGrlorscalaegocdlrxfuadmGapeoeeifUmlroirnemaretotesinrhrsiktzeafhzeiteeiikcnlvaatGiAmidl rpogeitlfGrenpeiwosArfseotrxrassctteaaetneeciuaitovtkrnrr edeidywdsoodekslAeu rslAmitgelsofnNrullaigfnlecttiabdnenrhscqPiiaewseczereoutaadnshirs ttitreu truaiureonsFetaepbnitrmoeticjt jaaoineelooletiircgptgennnosrtinri tobnvntsigelohtgi erritaaoiifmevynses QAweeft o xeixetIbpeprhsLlseseiitg n kcjhaosWTetetiehtnirhsooeaiei nnrlnpeeaagsyanyfiaoyadorfonheusmpafiorgppnaeachoarcmtieeryeaitbarmrlupenldfenarcuiutnsirontyethtyscisciptotpiitlfrpt oahooannerstsjsioior nirainfiFgonvvirrinaiosinntaitlyglvan tseGhbcemTeilrmaeheelreeefneoosktcbtcrreLlousiirngistiftatutemhstdc iaeoeognnnnlolttseinsgptd oesriaof wufscbeatewrsrhsdeaeesqmrl lteuhmoaeensnaisgtksInecoinathnesdoeurifilsv raNniedrfaaosutnthrhaiciooalpinntacsaehlywlaotciipuftmoethmeaeeinrssmsi knt ihictaNtmehibeaaeoiwtnpniuodtttmneivtr eahiamdseopusbppfioaeelnclirrciscaaaahnttctiaeicnaodpignan l Nationally 71 while only 50 of of naollnG rGereekesksgrgardaudautaet e Since 1J9u10st ic8e5s hoafvethbeeSeunpGrreemeekCourt 76 of Who s Who in America are Greek m7e0m boerfsthseinUc eS1 9P0r0eshidaevnetbse ceanbGinreeetk 76 of U S Senators are Greek Ocvaemrp8u5s esoaf rteohremgsaetnmuidzbaeetnristonloesfaGdreeresko nle7tt3e0r CarSriaenTUdeJnSrdBaidtmLdABaeeDuyrmvirflakaeewRlyyecnwCookBOBlooSiFuOn srdpCayfteb imfooaevMeannnleotmbn a luteSaNrTo srt rtiKagim GenWn aRvrBtcLMeieoilyuerlenHcaFtkRCaGhdaesleoerrdr PgaurvreiaRewrtKlintyel ci na gga Jn r QRtpjeho eodeiWctnuero chunpaMiattpittmaeeoilm restnanubrenteen wdrciintsriymnthuaiiteitpkotimaemgItbnieeesettnanrttstkeho ewiegnkoimttnsiatmoehktwmhereoe btwuhephgerrhesodn caifeGfmsersreueeetsnuktatoghlrrasgoteaulnNepicPsztaHiaotCninodnapssnreodsececeweuskhsltaauttnoraeddla recbethaecsrrhmueadiistnonteoregwwoahfnmfiecizerha mtAoiborlsegnorassnd uiuzStaritlituinizodgenettnhtothisseshteyilamewvceielt l HOW AND WHEN TO JOIN FJUtpmIGhofnRloieireinnSrevnPaGaiteinTecnjtnlnurok Persoe l gyd entsi aBoAwHlnfhsA CilaifiipaFasfveatFtEoiaetsfieCoecyinymeiigctiGlcrzdtllremlcaSOgoetsrliFeNiiertu1egiinaiemU faoue2daopnmaaodlifilqgebiefnlnlRepltnocoeGbcuvkotieGfddlElrrtureseioeerfiu eertgrastoetrttrlaMoeFYetoyddauonsierao cmaiefaOnihcdsrkamsatnrnSlnkGnsiicieselU xetlazpdeittldulrnGrnAiondaeutlmwieBsAdwotfstpfiirttosdemtesfeaitueiRwtthusraoezaek mmhesngbufEeibainnnrrnekriraatAmeeemncrmstdossoAngndmssfg N mirSftidNCttisaAjcttFgahzbemetokthrAeuueaaictgewsereidiraehwndlmlnatDyrersdtlliiteassM inrdieo rEhntouzMtaitdhgiekhnrciharMagclenumimageleppteeuvmwtasatiaImeehreliol ifsC tiicbaenvvieN egtniIstbmvotieeAhnirhiPoe eziebiarnnoafLesooalswGrsoipa utgtrlLuttirrW PuptFeitYtMsimoitiryArdconoffhoenoiuEueraentniarrcvmosimlntlLokspasolwaaifyt sIuso tlpgbtlsGii2thnegplcTlttneroliuwoI odhrocihri5oBfczobtpmaietsRnitetlLtge hoblahlthpdeyrEfubeInlnpeeanolesgeydprdoiOmtul diEerilesrorr nobefdoshtnecfimgwvmjreuuhaqteoacensinuciwvcnuunbetrtaersitiaiinigieofefirtotttrysehdeitneccfecoroedadocaeaGbonFleru gottqlmydoarnliloBnmriueoirlgetpsiomesnihpOuzdirclbtukeeerel phiaalib atd eAopnOtetmtorifodfv 2i rtet4 o SLaAtpseEarhtrueaClteolerrlOcNeninSseNdeGttmseowDAMsodr rGOweeiSenerarhTeagtdtiAehcabthtkhRenoheuiTCMezatBahrYIetertnahmOioofphetoUbnthereceRelmFrhdrrasRDaasiipn tEirwriStoSethteoonhcErircsteAlooohebrnRbraicyyetCrIyangnsvHniPeidnsmcerbinettomeiiivrnnoniefnggeoifiwauotohcbnnfNaeodewtiucgviowothhenntwarth ypt CMerhtsoleeaReewrumeGesast crenetwersh ueeaeteikednbtrmGudA p refaHgePfngarealteeeikz resaisisnnks ttwgleahiafnaekfebodtbe erpage TRflcctHeyhauceItarRerrrpuseDttinoeot trmnAampseTcrkneTaotmEqmguNarbpaeneDumsdrsstCsi IoaHntnnVotAsdaiPs lkeaisTetatoEartentRsahvbemmaElntiVoantyErnsgoeNyuewaTcvkibhSelnloanoubptwstetetiyrnahosdeutavh oveserergptSmiaostnsueaisdddzieaebvntlteiithoa enCaSernaoindgncthdeidatrom lcnhMeA toeteihttcdeeteinhsa die

609 748 2523 GENERAL CLEANING FLOORS CARPETS WINDOWS POWER WASHING ANTHONY BONELLI OWNER abonelli abelscleaningagency com Fax 609 748 9740 Mobile 609 703 1039 www abelscleaningagency com 609 748 2523 GENERAL CLEANING FLOORS CARPETS WINDOWS POWER WASHING DIANA BONELLI OWNER dbonelli abelscleaningagency com Fax 609 748 9740 www abelscleaningagency com

APPE TEASER BOX 25 Mozzarella Sticks Buffalo Wings Chicken Tenders with honey wHitohmouer omwan sdmeokPeod otnaitoon dCiphips mustard THE FAMILY MAN WICH BOX 45 2 Neil s Classic Burgers 2 Oven Roasted Turkey Sandwiches 2 Pulled Pork Sandwiches Crispy Potato Wedges 45 ITALGMILCaAiohnrzligicNzcukaiBerneFnrielwlPAaaiadtSrhM mtiSciagkIuasLnceaY FEAST 45 FAMILY SHSRhrIiMmpPScEamXpTi RAVAGANZA Grilled Shrimp Fried Shrimp Skewers Crispy Potato Wedges SMOKIN FAMILY BBQ 45 Rack of Ribs 2 Half Oven Smoked Chickens 1lb Pulled Pork with 4 slider rolls Crispy Potato Wedges Corn Bread 1lb Cole Slaw Athena s Nectar Spiced rum coconut rum melon liquor blue curacao pineapple juice 8 Hades Pitchfork Vodka gin rum tequila blue curacao sloe gin razzmatazz 8 50 Hermes Wings Mango vodka pineapple juice cranberry splash of 7up 8 Pandora s Gift Mango rum pineapple rum blue curacao pineapple juice splash of soda water 8 Aphrodite s Sokolata Vanilla vodka white dark Godiva dark de cacoa splash of cream 8 50 Robb s Key lime pie tini Vanilla vodka melon liquor lime juice pineapple juice cream 8 50 Dark and Stormy Gosling s dark rum ginger beer 8 Southern Peach Southern comfort peach schnapps cranberry splash of 7Up 8 Strawgerita Sweet revenge tequila triple sec sour mix lime juice 8 Strawberry Lemonade Tini Citron vodka sweet revenge splash of Sour simple syrup pink sugar rim 8 Chocolate Covered Coconut Tini Coconut rum Kahlua dark creme de cacoa white godiva baileys splash of cream 8 50 Appetizers Seafood Shrimp Scampi Grille Home Made Potato Chips 6 95 Served with our own creamy smoked onion dip Jumbo shrimp saut ed with garlic butter white wine and diced tomatoes tossed with linguini 21 95 Prime Rib Best on the Island Slow roasted for 16 hours and melts in your mouth Potato Skins 8 95 Halved potatoes stuffed with lots of cheese and real bacon bits roasted in the oven and served with sour cream Add crab 6 95 Baked Stuffed Crab 9 95 Lumps of fresh crab with the perfect amount of fresh herbs and seasoning baked and served in a crab shell and paired with wasabi tartar sauce Clams and Linguini Tender and sweet Littleneck clams saut ed with butter garlic white wine and diced tomatoes served over linguini 19 95 Beer Battered Fish And Chips Yuengling lager battered fish fillet served with crispy french fries homemade tartar sauce and lemon 18 95 Pan Seared Scallops Sea scallops pan seared topped with a lemon beurre blanc Queen cut 10 ounce 23 95 Neil s Cheese Selections King cut 14 ounce 29 95 Both cuts are served with potato and vegetable Famous Baby Back Ribs for Rsiaxchkooufrsri bSasenrrdvuebfidbnewisFdhiitlwehediftt2rhwiSM4eiats ti9hiAbgma5lannnepddnloaiopdrcnnreotsodelTmfedrHsaisppooclailkcnleWwiieven sCey i rnBsmB BmemeiQxoeLe ksGeocaBduhovrcaoieeect r oGsBloa1eCut4leldh a0acve0oistevaesenrrveoeedMSdaeewlrlmiletohoct nttPodiooasisn ntatnpRdoeinfiytegss jaBmlue Spicy Crispy Fried Calamari 9 95 Freshly prepared calamari dusted in seasoned flour and deep fried Tossed with spicy peppers Garlic Steamers 9 95 Tender and sweet little neck clams steamed Served with potato and vegetable 23 95 Seafood Alfredo Shrimp scallops and crab blended in a creamy alfredo sauce and served over linguini 25 95 to1p28eorofuuenncSccteieeorsvnNteeo denfanwdUwde iSrtYth oUDopp G rSpAo2ko e tD8CRatdSs th eAo9wwtSod r5aimiaiCctnpDhelhoddrobSckaviPlecteegeneeuudgotabeebncNkrtehCaBMeucebhfuteleuseegts se erelitHislrgableeohurLdudttwltosyeSiervt eheceurCdsrhea1idCvn4edhS 0aaeB0nlreadosmwOein nWSiAoelhnelo eWlMeciostGoicrodoanyninsBiMnluuCes htPeardreddtazer ls in butter garlic A summer time favorite Scallops Wrapped in Bacon 9 95 Sea scallops wrapped in smoky bacon and cooked to perfection Simply delicious Captain Dan s Sweet Potato Fries 6 95 Served crisp and delicious with a sweet and spicy secret dipping sauce Boneless Buffalo Tenders 7 95 Juicy chicken tenders are fried and tossed with a spicy buffalo sauce Bleu cheese dressing and celery are served alongside Jumbo Shrimp Cocktail 10 95 Chilled jumbo shrimp paired with our zesty cocktail sauce and lemon Mozzarella Sticks 6 95 Deep fried cheesy deliciousness Served with homemade marinara Sirloin Bruschetta 8 95 NY strip grilled to perfection sliced and set on toast points with fresh tomato bruschetta YUMMY Salads House Mix Salad 4 00 Fresh spring mix and Iceberg lettuce with cherry tomato cucumber and red onion Add to any entr e for 1 50 Caesar Salad 7 00 Crisp Romaine shaved Parmesan herbed croutons and our own Caesar dressing Frutti di Mare A little spice and a whole lot of seafood simmered in a rich tomato sauce and served over linguini 25 95 Broiled Twin Lobster Tails Two 4oz cold water lobster tails Served with potato and vegetable 31 95 seasoned and grilled just the way you like it Served with potato and vegetable Neil s H 30 95 Sal ouse Wines by Steak and Crab Cake mon Creek Cellars 36oofuonucSreemrUvo eSWud tDhhw iAiwtte hCatZhpeooirniticnafeagtonfifardlieneetddls vmePeriivgnneeiodtctarabGalloberni cggaisokid eesC ha6rd 5o0n ngalay sMs erlot Cabernet Sauvignon Blanc Chef s Fresh Catch of the Day Selection varies every day Check with your server for White Wines 26 95 Steak and Shrimp AampaoPiuartnnoovtdkfeooacgfyrebha strbeaesrsbabBeSldSsesleeaete uracdrhkvfntvFofeieaeedormdndddnisdewe ewwSMmSdliaitiiegttthsaahhSurhodvprtnfhwleeluok21fyidrnatemce49aifgsodwrmttp asico99esibkPtCapd55ahiton rarntfpDdiSaaidclforerbitstevtehnraaaevserDnuteghnoscdeeiaecnabtrwua rnanabcadkiFFbtVeeAlnEePhLeAClvJl Adridail uiiuevpgeluhgnkslvgstaonemdhoaahoteetpmnaoattntttrpraeihtceorucedoSNSbeninGoaraialiofao euotpueinPsD nlneSndcPdirSMtgrganabrfiyCoeotuoyoSnecPPhsRvt sta ieAiainoGncgvMcrrsoaordnictg ittti6eoogocen GGsnniolhoo R arnruLen BiiiJnagogolICluctlyBijaiuaeoaohem nlnl 6 aaUyURcMigNASnrlno iideSlpceeaEudHoMto S os4aw DnraDoanelNaicSIIRkwi oAnwtnrUnAerZpaeeuvAdla ngMebeUlwnadwCRiyy dgaco ib h nSEoReCleruZoCwaC uotA iDoeS SacntialuetIlRa doeltdhuuAlgirCauilEf fma firyhooptlCopfhylnoo o re23ohrbnluadtntANtoW61aiwaianafiiatel caratoiin99doitwkeVrchdm 55aaaefiTaanfinZ llunlydevrereldeoreetoyva fddubv egplrsaecWcgrategienesielrnlaentdtereatettsdedeatbaharrbl jwkieiulljne u mitg ihcbtyooanshrimp MEDIUM Pink warm center cooked through Veal Chicken MEDIUM WELL Cooked through no pink WELL We are NOT responsible for steaks House Favorites Red Wines A gdeeneeprofruisedp oarntCidohntiocopfkpbeeodnnwePlieatshrsmmcohizgiczikaaernenlalbareOcCJhapuaseirltec ipsabiei rnJeaCeaanhdtdmoieadenD stoi PgIitanajoloytloNoSiur pCearlTifuosrncaian ordered well done Tuscany Italy Glass 8 00 7 50 8 00 7 50 8 50 7 50 8 00 7 50 7 50 7 50 8 50 Sandwiches Spharouomats nceedimudfitatvnodeiesaahlnmetdGKodapaetrowipnrnpediastpdhreeeawdnay2s2i wgat0Ss3haui tt rc9aCh9aleis5ch5ta pegSwiaceerhVakdrivegteeseuahndswlaoarinCpEvn1F2ZWeeden4po5irslnrtoixllmoaHriLaponvueBpaargohcdsolungreooCburoidtunnmraeeoeisnid lndkaoaCgnsBsSaeilhTabMabeiceuramyarOln zbRpe lBedortClcaabVSa nuielaAni irfulreotlgRvorSMeZien CgwonidihnCnoautiitfoiacCnBhntaknshdhlanmeet aiSndinCcolCevledzbakaorizlrv erleayMeuMoLarndmeLsloeoiltoPlendrabnnfloairaois cianrethtCmP d aKeVaCuSn9eatailosiatglpi ls fle9llpeaieeoiSa5efraiyrdonrpnnnr frodeaPWainlacliomintawSairoasaikntrhhin niSandfarnargiweadntsoistdcoanwphupcieecd h 8 00 7 50 7 50 8 00 7 50 8 00 8 00 Classic Wedge Salad 7 50 Saut ed chicken breast artichoke hearts capers and chopped Cooked low and slow in our smoker for about 14 hours 7 50 Wedge of Iceberg lettuce fresh Jersey tomato crumbled bacon purple onion and bleu cheese dressing Great for sharing tomatoes witShelrovtesdofwfirtehspholteamtooann danvdegaeltiOagbhplteibc uittSearynsgaruiacea vailable by the Smothered in BBQ sauce gSlearsvsedoornpaitcBhrioecrhe roll with fries 21 95 9 95 Glass 8 50 Add grilled chicken Add 5 grilled shrimp Add 6oz filet 5 95 7 95 12 95 Soups Neil s Award Winning Clam Chowder Cup 4 75 Bowl 5 95 French Onion Soup Crock 5 00 Side Orders Baked Idaho potato 2 50 Sweet Potato Mash 2 50 Crispy fries 4 00 Cole slaw 2 00 Fresh Seasonal Vegetables 3 00 Neil s Trilogy A 6ounce U S D A choice filet a grilled chicken breast and 3 shrimp Dejon cooked to perfection Served with potato vegetable 27 95 Veal Parmigiana Tender milk fed veal breaded deep fried and topped with mozzarella cheese and homemade marinara sauce Served over linguini 22 95 Pasta From Hell Scallops shrimp and crab in a spicy alfredo sauce served over linguini 25 95 Neil s Wildwood Veal Fresh veal saut ed and topped with shrimp scallops lump crabmeat and mushrooms finished with a garlic basil wine sauce A MUST have 28 95 Veal Marsala Tender veal saut ed with butter mushrooms and sweet ONEHOPE Wine PB J Burger PNul1ele id2l pspooOruknw dbwnabicutSorhPgnmre eorjov adkSelauerepcyrdeveneb1dTodo2suito ntr9nalke5npaedasByroprteilBnodpcerphebrGeesayrlhRsajdaiotspcolslkSnww8aaciih nttt5ihehnde0fgwsRrieeoHiscobA nBhLMaoFtotolnefdt2ah4vei 0pJ0rro fitms atokepsaratnneimr cpaaucstes tSurmkoekyebdrtefooamrsta6wtohi othSuercsrr vahendabneodrnrcyaacrBhvrueiotdncteheyeOn drbNoealErlcoHwanniOStdhsPutjrfupEriipipcesCysolasretmlttiOufoockuerernd TiraooZpinsfandel 10 95 Beer Crispy beer bBaatttetreedrefidshFfiilsehtO lSNetaEtFunHicgdOehwPatnEiAcdghCtaoaimnliasfttooBrnreiaasCthCaarndcoenrnay Served on a Kaiser roll with fries Neil s 10 O95NEHOPE California Classic Burger Save Our Sauvignon Planet Blanc HaAlfmpeoruicnadnbcuhrgeeersec oSoekrevde9Odto No9ynE5ouaHrBOlirPkioiHEncgehC elpaarnolCdilflhotwoirlpidtnphrieeafdrnieCwswaithibtherAnuettisSmauvignon ONEHOPE ECnadliCfohrinldiahoBorduHt uSnpgaerrkling Wine Marsala wine served with potato and vegetable Saut ed mushrooms 3 50 22 95 Saut ed onions 2 50 Vegetarian Napoleon A Napoleon of fresh veggies layered between fresh pasta sheets in a casserole with our creamy roasted red pepper sauce 17 95 Ask about our Gluten Free Options 3 00 Plate Splitting Charge To Avoid Confusion Separate Checks Will Not Be Written Bottle 22 00 21 00 22 00 21 00 26 00 24 00 21 00 22 00 22 00 21 00 21 00 24 00 22 00 21 00 21 00 26 00 22 00 21 00 22 00 22 00 21 00 Pitcher 24 00

REAL WORLD PHOTOGRAPHIC MOCK UP SERVICES

AIR DUCT CLEANING DRYER VENT CLEANING HEATER MAINTENANCE AIR CONDITIONING CLEANING DONALD LEADLEY 856 834 6626 F 609 289 5269 TheDuctDoctors gmail com LET S CLEAR THE AIR

SAVE THE DATE POSTCARD PRINTED ON 16 PT PEARLECENT STOCK FACEBOOK SOCIAL MEDIA EVENT COVER IMAGE

BRIDAL SHOWER STD PC PRINTED ON 16 PT PEARLECENT STOCK FACEBOOK SOCIAL MEDIA EVENT COVER IMAGE

FACEBOOK SOCIAL MEDIA EVENT COVER IMAGE

PHOTOBOOTH BACKGROUND ALL PRINTED MATERIALS PRINTED ON 16 PT PEARLECENT STOCK

THANK YOU POSTCARD

ANCIENT VISION CD TRACK ART

ANCIENT VISION CD DIGIPACK

NOVEMBER TRANCE TRACK ART

SEACURE BEKINS TRIFOLD BROCHURE

PAVAROTTI AND PANCAKES BOOK COVER FGRAN7 001_Pavarotti PancakesCover_505Pg 6x9 1 09 18 ALLBlue_alt5 pdf 1 2 28 18 4 16 PM Pavarotti and Pancakes is an epic story a memoir loaded with dramatic urgency and generational abuse Francesco Granieri shares his journey with us through an embracing and engaging writing style that warms the heart Pavarotti and Pancakes An Italian American family torn apart by Old World secrets Their lives ravaged by cruelty and years of sexual abuse The true story and lasting impact of covering up childhood chaos PAVAROTTI AND PANCAKES FRANCESCO GRANIERI Francesco s writing enthralls the style is compelling and reminiscent of the fireside storytelling tradition in Southern Europe He certainly follows Hemingway s advice to write hard and clear about what hurts DAN SANTOS Author of The Insurrection Trilogy As a 25 year veteran of the NFL I am always looking for that edge After reading Pavarotti and Pancakes I was inspired by Francesco s message of perseverance PAUL ALEXANDER Offensive Line Coach for The Dallas Cowboys and author of Perform FRANCESCO GRANIERI is an Emmy Award winning Graphics Interface Coordinator for ESPN ABC He lives at the Jersey Shore and loves his family Francesco Granieri Pavarotti and Pancakes provides a unique perspective of life behind the closed doors of mental illness Dick Vitale ESPN A Memoir

CAPE MAY DISTILLERY LABELS AND CREATIVE DESIGNED THROUGH OMEGA HIGH IMPACT PRINT SOLUTIONS Proudly Producing Hand Crafted Spirits from the Cape Our story began as the dream of two college friends with a love of distilling and a passion to make their place in the industry Through hard work and the help of others who shared this dream Cape May Distillery was born As historic Cape May County s first craft distillery we produce a variety of hand crafted spirits We hope you enjoy Scan To Get Our Full Story Bottled by CMY Distillery LLC Cape May Court House NJ A256814 CMYDistillery_HoneyShineArtConcept1 indd 1 Proudly Producing Hand Crafted Spirits from the Cape Our story began as the dream of two college friends with a love of distilling and a passion to make their place in the industry Through hard work and the help of others who shared this dream Cape May Distillery was born As historic Cape May County s first craft distillery we produce a variety of hand crafted spirits We hope you enjoy Scan To Get Our Full Story Bottled by CMY Distillery LLC Cape May Court House NJ 252269 CMDistilleryFlyer 4x9 indd 1 252269 CMDistille1r y6F 1ly7er 44 x293 PinMdd 2 A251149 CMYDistilleryLabels_Prod8X5 5 indd 2 1 6 17 4 23 PM Proudly Producing Hand Crafted Spirits from the Cape Our story began as the dream of two college friends with a love of distilling and a passion to make their place in the industry Through hard work and the help of others who shared this dream Cape May Distillery was born As historic Cape May County s first craft distillery we produce a variety of hand crafted spirits We hope you enjoy Scan To Get Our Full Story Bottled by CMY Distillery LLC Cape May Court House NJ SPproiruitdslyfrPormodtuhceinCgapHea nd Crafted stTppaohOhhlafeaalursotcrorhsvweeuesiedoogitlnponothchfrtoothyihdoflsaleibeomsrdegtitdrnahgieelwdkaelaifuenrnormssigrtaet khwsnareyahndti nhordsdewaditrheam Cape May Distillery wfiCwreaaspspterbcoMrodaraufntyc edACisosuthinlilstetyro ysr ic a variety of hand hcorapfeteydouspeinrijtosy We Scan To Get Our Full Story Bottled by CMY Distillery LLC CCaappeeMMaayy DCiosutirltleHroy ucsoem NJ A256814 CMYDistillery_BackBayBourbonArt Approved indd 1 c adGGab2uieO ulriinsVtCeneEyrogRtahnlpoe NsraudelMwrtgiEomhvnpNmetapTiernaonocWncbyslAaohebrfRoemNoaucIlrsl acNdouoGp nsheoe ortl1iao tfdcretiAbhcnemeckvaoreaicrrlshdaciikgonneohegfsrotliyib oicrmtatpbhnhaeeidvdrSesemrfuyareayogcgtueersos n A251149 CMYDistilleryLabels_Prod8X5 5 indd 3 Proudly Producing Hand Crafted Spirits from the Cape Our story began as the dream of two college friends with a love of distilling and a passion to make their place in the industry Through hard work and the help of others who shared this dream Cape May Distillery was born As historic Cape May County s first craft distillery we produce a variety of hand crafted spirits We hope you enjoy Scan To Get Our Full Story 8 65244 00011 3 bbGeewvOcoeaVmruEaesRgneNeossMhfiEmothNupeTladriWirnsasAoknytRdoodNfumrIbirNnaiaGryktb hcai lalid1ctu yeosAfhteeocochcldtieocsrar ibvdl teei2hnva gepCcrrtaooaogbrntelhosesuremdmoSsuppu retriringoagentoeponrmfeGaagelcncnhaoeinhnrcBCCaoeyoMallr itpycYte leDMdisabtyyilCleoruyrtLLHCouse NJ Bottled by CMYDistillery LLC Cape May Court House NJ 1 12 18 11 01 AM CMDistilleryLabels_Honey_3 125x5 75 Rev indd 1 A256814 CMYDistillery_SaltedCaramelAppleArtConcept1 indd 1 1 23 17 10 19 AM Government Warning 1 According to the Surgeon General women should not drink alcoholic beverages during pregnancy because of the risk of birth defects 2 Consumption of alcoholic beverages impairs your ability to drive a car or operate machinery and may cause health problems GOVERNMENT WARNING 1 According to the Surgeon General women should not drink alcoholic beverages during pregnancy because of the risk of birth defects 2 Consumption of alcoholic beverages impairs your ability to drive a car or operate machinery and may cause health problems 8 65244 00011 3 8 65244 00011 3 GOVERNMENT WARNING 1 According to the Surgeon General women should not drink alcoholic beverages during pregnancy because of the risk of birth defects 2 Consumption of alcoholic beverages impairs your ability to drive a car or operate machinery and may cause health problems 10 18 17 9 14 AM 1 10 17 12 35 PM 1 10 17 12 35 PM 10 24 17 2 34 PM Government Warning 1 According to the Surgeon General women should not drink alcoholic beverages during pregnancy because of the risk of birth defects 2 Consumption of alcoholic beverages impairs your ability to drive a car or operate machinery and may cause health problems 8 65244 00011 3 8 65244 00010 6

LITTLE EGG THEATER COMPANY PRESENTS LITTLE EGG THEATER COMPANY PRESENTS FRI SAT SUN SEPT SEPT SEPT 7 8 9 7 30PM 7 30PM 2 00PM BASED ON THE MOVIE BY REGINALD ROSE ADAPTED FOR THE STAGE BY SHERMAN L SERGEL SEPTEMBER 7 L E H COMMUNITY CENTER 8 DIREC 9 TED 2018 BY KEVIN BERDINI WTL3LTTII1IHICTWTC9IKTTKSWWanELmpfLtEmSorhiEETeEe agTe rueLVrSsekuStEsCItEEetimTPBojaNigGeAuG NnRTnrYinerrt1OeGLOGL sTo n12aboDWAErr9tRt IHsseohfHUpE5SBGE re5aeCgGAAAbenGE RBrErgmGexRVsoIRNajDEYuaugoNAwTaBBEEamriO1nAHnnBIoOrR9ZaOhLCisLYdrEn olA AeERy DReArta oaeBLhS dtWTswptBaChPiRNe LAnRetroaERtdEOOhg AnhDJEmtCo IeS iMeOYC NwnMTIlaEdA1gOhNmBneG M2LIem uSLutawCjYAhtjIurUaSAruONdeeOpeDrnRIrNoeMeOEoAUhRnorrhrrIaNAsPoRtsAsaTihvsNtoT a sTiYeeOfGnfrrNEiirjeeeEanWnusCDO dMlao steEaiNltttbEeBRnNkvksiyyNaYEeseCnteTTc monSroUsdtwEoSEweaiWiSndRcHtiRditnoltHIthEoVttTaarbIoRteEnHOithneahaMcdDedNflecooTaAfhS hmrHfob eaNonEErljee DcwueAtWatrdLwIDhsToDkto eR heIrwmjNAe uWSrfhMayTenurGEaythvrErAtvaR deeioresTlDMeGoaatIsroEOnlchiCiEtsntmoLhiaOhsNgtbPa rihRptT beUIhiStlwnriaIBianesOlgtDoLciOgmloNiloIIetsPoSrRkaok bHEeFsrfhEgkoReINeahCalaNripErnikiTnbGsn3eEdoyEl0bewofoCadDCaeurMOnenttfOhhloMcooBocIFeirinNnsYPdpheFreg AeeatUEth nrNhbKEToaeaH Yey nEEbaceeioorVSnttdOehuuddegIFrPerto yNesaReevdgWhsoessIeuBuOOf nrtmiEdthlOy TRttiRceooDecosacuTDSmtvrt srrTOaIapiaWeNnsOnrec SienCIdoeryaoKHsu ua stc sO gnhecesttWIoneiahLtlucsyaLsoTletdshnIniImNMoocentOfrehootoIEa e tS f 7 20 18 2 48 PM LETCO8 005 12AngryJurors 6x4 indd 1 LETCO8 005 12AngryJurors 6x4 indd 2 SPECIAL THANKS TO SLeitaGtVl CeiMcuEtragoetgrtiMhaHeoaEwvrdibdnDoygirx fToIrnooncwma nt JsJahJeniespetf fesrrCeLGyuinrtVaadrpwaeheaCilyxiacncdo 7 20 18 2 48 PM LITTLE EGG THEATER PRESENTS COMPANY LETCO8 005 12AngryJurors 24x16 LawnSign Final pdf 1 8 15 18 2 47 PM For omnoFreacinefbooromkaattioLTnithotelnetiLrhfEEuesTguitMrugCpohrapOTfeeyohLlogppreitrirtvawtoiRelstdeirsatwuehEyacaCgtGtrvhgiomooeisHrrnolmyyrsaa rnsrlsebaepedyocueeferdacuoiiTnivttanoudieleowrdTtneohnHasfpesnAourhdCorNsipodatKaouupffoncYptvretcOroieriollUucntinhstateo teesedhr ojwoi n us LETCO OFFICERS President Vice President Secretary Treasurer Board of Trustees Jim Henry Julie Shutz Mary Henry Tonya Neuweiler Aline Bernstein Rose Faiss Ellen Voorhees IcpconmiTosroftohmiemscaertsmmfheiao5Leeuuindti0nnthscti1itl itoFesycymo oEt3miodsgoAugnrPegnonaTainptntdnhypeoto ierrrrzntoyataaai afitotinrHtintneoeda ndobCergoignotifaavrmsteintucpofiehczoabaharnacttHyhihcoaekuna mLssctEwahoulTnohlottiCwtocuthhyasOr ese eel LETCO8 009_12AngryJurorsProgramBook indd 1 BASED ON THE MOVIE BY ADAPTED FOR THE STAGE REGINALD ROSE BY SHERMAN L SERGEL SEPTEMBER SEPTEMBER SEPTEMBER 7 8 9 7 30 7 30 2 00 LD IER EHC TCEDOMBMY UKNEIVTIYN CENTER BERDINI 9 4 18 12 46 PM

ThLeILTipTtretLsleeEntsEEgGgGThTeHaEtAreTECRomCpOaMnyPANY PRESENTS The Little Egg Theatre Company presents BASED ON THE MOVIE BY REGINALD ROSE ADAPTED FOR THE STAGE BY SHERMAN L SERGEL March 29 30 31 SEPTEMBER 7 8 9 2018 WDEdirriwtetcaetrdnedTbhyboyMrtToaonrnyLyECaHhNTaesCueowmeimlerunity Center Llit tEle eHg gthCeOatMreMco UcoNmITY CENTER DIRECTED BY KEVIN BERDINI 2 12 19 1 52 PM Friday March 29 at Saturday March 30 Sunday March 31 at 7 30pm at 7 30pm 2 00pm WTLt3hLTETET oWII1rIeHlDIICTWTowC9 arvIKTWuTKSrfoWeWsLEbaLEoaiAEETlwmE Te dntLVSRSECiIriEiElPtTteDsyNGaAG NT s rDO1GeLGLTHtTi2luoAWEHeaan HImHwESBdnrGOGAvAA ddREwBReOGRVbRNeEiyYTniAnTBBstEEOOsilHyhIpsyORZOLiCNEserAEAaRaR teAcsntBML aWTiCBtaNLoilARhnilEORnAalteJEDvyyIMOYCiiNMensrffONoonGicMIbyr rdLSlCluYhIeU4SOdNdOe0INsoCMiEOrUniyexINdgAeRTs haaTa YhOVuNrnaiesWsgCdOthaf EsaNratRnNiere edECerhTn SaU aIEdM EllmSiRfRzHd yHefVhraoItiEatOrlohevrDpNtae pMetS tyya mEailcDtnlAeoarItT aDyasVIlbbaNleeWeboytGdaifEHtI hdvaDMTieersoObvEcfsOeaNiiidnyyvRsTeaotSiIessliOldrTnOytNo VfPtowueEFshttoRnuoNaanrEv bsey3eEoa0seuadECoMmtlOcawobIFifNavoNtaFeeloUErrgrrdeETaaai Ectsult lShso memwPremRiennIigOttitsfRleo edrTrO SHOWTIME LETCO1 001 Harvey 6x4 PC indd 1 LETCO1 001 Harvey 6x4 PC indd 2 LETCO1 001 Harvey 24x16 LawnSign pdf 1 2 15 19 9 34 AM The Little Egg Theatre Company presents LittlSe EPgEg HCaIrAboLr TTowHnsAhNip K SLinTdaOC icco Victoria Eddy from Jane s Cutaway Sea Cure Moving Inc Jeffrey Vreeland Habitat for Humanity Church of the Holy Spirit Green Acres Antiques Waretown G Matthew Dixon at Jester Graphix 2 12 19 1 52 PM TheprLeistetnletsEgg Theatre Company Written by Mary Chase Directed by Tonya Neuweiler MARCH 29 30 7 30PM MARCH 31 2PM EDWARD THORTON LITTLE EGG HARBOR COMMUNITY CENTER TICKETS AT DOOR OR WWW LITTEEGGTHEATRECO COM ThetiLrhEMesTuiraCpoyhpOofeorLlgprBititvwtaielsreistbwhEaaagrtrvahgmeiJsHrloyyaarnsrCbepdroceefercauiTivtaaouelnwrdTdenHatpsnhArhdeoNipdaCKupfoocYpurtOrnieoUccniilstao ted For omnoFreacinefbooromkaattioLnitotlnefEugtugrTehperaotdruecCtioonors saeuedoitnieonosf or us to volunteer join after the show us IcpconmiTosroftohmiemscaertsmmfheiao5Leeuuindti0nnthscti1itl itoFesycymo oEt3miodsgoAugnrPegnonaTainptntdnhypeoto ierrrrzntoyataaai afitotinrHtintneoeda ndobCergoignotifaavrmsteintucpofiehczoabaharnacttHyhihcoaekuna mLssctEwahoulTnohlottiCwtocuthhyasOr ese eel LETCO9 002_HarveyProgramBook 11x8 5 Final indd 1 DWirrietctteendbbyyMTaornyyaChNaesueweiler March 2E9dw ard3T0ho rton7L E3H0TpCmomm unMitay Crecnhter31 2pm littleeggtheatreco com 3 27 19 12 29 PM

CrabseconTShirt B W Red ShirtMockUp pdf 1 8 23 18 5 26 PM CrabseconTShirt B W Red ShirtMockUp pdf 3 8 23 18 5 26 PM CrabseconTShirt B W Red ShirtMockUp pdf 3 8 23 18 5 26 PM 9 15 18 MUSIC FOOD ART GAMES WWW CRABSECON COM Front of shirt Front Front COLORING BOOK Crabsecon com Crabsecon com OPTIONOBPTION B Back Back ARTIST S NAME ARTIST S NAME ARTIST S NAME ARTIST S NAME ARTIST S NAME WORK NOT PICTURED WEBSITE WWW CRABSECON COM

APPET NEW ENGLAND CUP 4 50 CLAM CHOWDER BOWL 6 00 TONY ANhoDmeVmAaLde SblCueObeCrrOyNdiUppTingSsHauRcIeMP 9 95 SHerOveMdEwiMth AouDr EowPnOcrTeAamTyOsmCoHkeIdPoSni6on 9d5ip Smoked anAd sNeGrvEedLa sSisW oIrNtoGssSed8w 9ith5BBQ sauce JuicByscUahuFicceFk eASneLtrevOneddCearHslofInrCgiesKdidEaenNbdletFousIcsNheedGeiEnseRadSsrpei8scsy i9nb5guffalo I ZfreJEsuhmRhsbehoBreSblAlulsmaKanpnEddfDrpesaseSihraeTscdorUnawibFnitgwFh biEwtahDaktsehaCdebapRi nteaAdrrfBtesaecrrt8svaae m9udoc5inuen at of crab HoCmHeImCaKdeEacNghuicaPkveOanTdpipoSpt TisntIgicCskKaeurEsc ReseSrv8e d9w5ith NY sptoriiSpntIgsRrwilLlietOhd ftIroNepsehBrtfRoemcUtaiSotonC bsHrluicEsecTdhT eatAtnad8YsU e9Mt5oMnYto ast FdreSeesPphIlfyrCipeYrde pCTaoRrsesIdeSdcPawYlaitmhFasRrpiiIdcEuy sDpteeCpdpAinerLsse AacMsaopAneerRsd Iflao9nud r9 b5aansdil Flash frieSdAshUaTllo tsE DolivAaeRntdaTphIeeCnrabHdseO KtoEmSato9 le9m5on butter Tossed withHCNuTAb oaEpnp NesCCpdiLUcwDeAiBtshMAahnCNoCdmsHFeU emOrRvaWeITdEdeDSwcAiFlt9ahmF a9RRcc5hrIoeEIwaESmdey1rSc2il a0n0tro sauce Pepper jePlulyll TebRdapcUPooaFrnkrFma pnLeedsEpaGcpnDreEecraTPhjmaeAIcecNkRshDeceM MOhefeErsCYedeSsdKchBaAorrFEmNocRsLbheo eLImeEtYhsaRSaeryOtF byaRS1oanu2cEIdoE nMan0eS tA0vojea1uRrlca2kYhpn e0oeFnfw0oRtrsyuIoafEfluneSdnoes9icel ad 9lelid5oninsyour life ADD GRILLED SAL ADS CHICKEN 4 95 GRILLED COBB SALAD XX XX Discription SHRIMP 5 6 95 Discription A litt1le2AosDpuSinSDacSscaue aaeutPulG atmcrt enoR 1e1oedSdSve n4DnId0eoAlcdaCLtoOrOelfichVoOvwowLHrlZhiZneeAcncEihOedrtCckiIKuoooQDbeLkIawtanlIernNKCeUAnLsssNoiSn tdttBEliEEhai orEelSGHneNifiLar1tdEpWpeSOMdtfnaRsoEiroCrONKefsc2pieFfvaostsIOrthUaTaesRYEsnerMvhp5CorhtCHedNedae1iToaPONTkcPaUdk6FdlUHwgteyeafHAPoR SDlh uowTiRmR iinIhpntgco2soS5KEChRdEIieSpoUhSr tu da6L haTeeKYnDaptvr2HlI sSTrgadsenLoy6Ap9AEa tN i1Ma msgSdmtToTOw ns5aYaNr 9etSyeFdlIimR9tnaiciRmtECot5acTaAAdTtha5aR1eDIospHEbapaHlrP7moaLfloOlIenBaienRrRegnR rIeedCdlMnrd9MtMiASUheCsdgledItiv9tdbHonhKOsTdaBAKeSvbuEtHaniIEsagEOpeNutAnRElndtCaeergtEDerARTdotyOutNmieEEcerKca2osULcKtghrSosShbcauFe1EyrRoL2a2nlibrTiHSteulp 2asuNDo3ll1md9UteeapncRmB2tAi doueo5dleF99l2I aYcdu jEMt9btF5tu53oeStooeth 5sEpoPseE utss9pmWrDratvee2Frh5aueHrdde1CetcdoIww ewRLbe9w iilsEatA5taaihh tynnhBIwpacyTdpaigotsoLsheu7ettdA aallro9ivtSksto5eehsT daSiotro f pver linguini SA N DW I C H E S JMAN8 004CSCDBYYopioOnaoHoinuSSc cfukeWrHImrymIoPretBMSCeCendiCBoomAPneCmhdUGhnKktsuSLeArhuogUWeooiorfita_nFnEeisefirdki8dcwlapcHLipdr lieApF5HNceeOlepBFeSyxoadLsASdAoT1dlfAMItOeeOOeBR4hwSnrTLIIETCB dreIDfciLfuaieAnAdoanvr6UEixSaGBeDdesOGrttemurDneOdStHBtekNisbArQSOsdecurddRieaslOoebiaPl1oCrecSelElSOUytCCAleuGrqeprCDwo eeheCvOglhndrdBTarAe deHTSrSsS HteiOdLKvISRercAFenO alnHOeerseeSIiMsieksHadNIuTcersKnpaCtrBdwOeeraoSCtcAlehaFsiBsvfOuFCntr omuoOeKtnr BteAiRiKOrFSoclrNSnoireKdRBinAdeaWduigSeeEfeclLN SOAuEnodterDcC sedAEPrOdRhoeimNhhatEvFCeNtArNDaCre a eWnaChDrsvBerOoorhlrSLUhlcsegteShfiWRDdvASvrCkeeeoeietSsLIsdiiecoooTehecoTtrdoOCrThWAkBtdSIkaAllrfIvosOkceoUuolEnB CerNnrGdeHeeNFhTApWc2nnNIie nbe doAoDRneae9pogHeeCCADANe5eCrrcgnirBDe 9OBtrKRBscAd rtHhdhAuBdLWrsoBLrDmn1ro eWrMneeeneEymb e9FiarWlnEtAdo1reaAWtlGaoy9iarRICYbt5aoIicisATniuEuC sTolieoSnhl CBsctth9oeIooctct9nahs lu Th HrrrelSmCsme1Hd5SteSitT5meAB oa4nRCIaloHaAaAEeJsLiceR9CcyetvHsohSt1eunoheRyooNcesyle lotridl 1 0eooica9etldeVcWunuluCgDyd0T trRse5erHacEr9orsseioEu iWnesamD aG95lkmAurmlDAeinoa5OtnbdWfs hntGefdulooAderboIEcjAddeTTocboBHHtSoktCeraoonEdAPcHMFemgHiunoiaLaRlgHegllsnnEllr smfAaeeeI OaPsdCEEPldcOasfinDeeh hoSdSnPPWnuepeAutsseiosopoE8epdn iutre1teCnAtdd khcsS nlr 9rSali 2 SaRAedebAAMJrBlBa5elCPAalyVlaOnmDBeeeCuaPuomifscfLdcLPEhruceiDsUuyTsBkgytoeraoahHrAAnicGSeguxoiSCeTnnrCo Ocdo reehSonoDse A hFiaEmaFklrrNJBoBeJroevAaeSWnvrBNvemCedallurien9el ae1elBICcmOtomlrisutDsdSoaecdl dCgrh2oele er9UaoPoawpk tneOVekE raoB9dueiedF5CTriRelBieAangRnne yseinnrthUdsrrIagmeinSsB eAoUaeyGVeOmBeCnedeTd sRCdeoed sU BclBoNERr PneiDhgLsacTvhOGsrArPnueaYeReRoeauSGreiidlnomDoonilptpEendcCze tpGicEicudporp souznra1BhORnOheihrgleecencERPesd1ea2esepernrLidse eadt eess scRiti woR0kRiAPs psi9WAoA9noW 1nuioeoJo0psrnnbnn s1gB5r o0liajle9igOeltDdkultvrE1hlcrnh a5inrotSTd9oAJA eBtpieSlooe9cooa5rsneaCmrcrhncncs5dinvhcoreiHeakaeoonaoTntkrRsCgcCnogoeedho hph mAalepeIlteeeeeMmFasdstsr eeaiipneoydduioclat rtTyeh dearer1e0iss 3ae r1pvl8eadtesr1eas1awp fl3oiot7HotridnAuo gnMsmcdhheeeParllrmficgAsoehaookNodHefrged e2 AegS oP9gnr5YsaEec mosrWFBAnMatoaArtayaaeFueRnAiiaknnpAssdlRcesEowhaRnrpFr dseGiIdDrmoihraeDSBBtEessrabhaRoaSeceSohsty DrvnOfsiHheySshnrSecIeoeEdAoocioreelBaLBeTrnameRuaeHnnrSSveaerbdglSFdrtMacLeAioAapaeaerFessvSnadneEiA bit8ssFsAfcn nddeoeArUidEtoegSKkrKsoasvtsbruBAdIjdndveRcrsroeSwuMeaVunnDeceosvEoBeeSfErkdrMmrnwTAFmFadafstIeiAncdedeWvo rOtauuDdDCnElrdohbeeHiOHkObedSaKbwlSInftwCbcdodjtiUoalhfhsdrLeHcDAoO wlpdeorfeRbiOpMUElsfiHcsiootrHteaoosstVapmAwdtShksVahiilstIhmAraelDtDhlsettnoNSnE AEllSoeewaChoIFaaBidwAFoaeSddrpdteatO cCtMnrFefttiEhriaNDpeDDvip nRmKLoyminooSClwhFichHrlCbattgaesntbeRoKtFAhdvrosiLraorEEDApeaatIahaET iciOsateesDtrueRonlsD dpvEaaIkEddSlhnitiaakEkslssUmuOdYceNaseociaedSSEMpe teeadeIbhnehahDmsNokesn YnrroedbwMduCnalUrdFdCsuCDegeytmSvedIGBscisdpaspaPdnpmttdeieen bevetFSKNSPkt 2MAonasnFSCoAtdosR IHcwhgAterCrpwessSudrldicwNEHuoae6loDavpAeLgvipAieSApdbn1SalRnknlnLaetafileCA vteIeie aDeyeAthaARodLaucfaddnds9efhl9ewRrCVgotiPaeMArrfitfabfthfSrataYdssgsfaOTIele ye5vho iahilCeySYelsAbecVylotMTlMe9teSIftosbecaaCveohIacucoraPslaaFs tGSAhRreexrdtwMnoO5itlmathba SslePi iage oPoaiRlSrlotad cO boIaLoowlkAud1etmeaNavnnPlenHeoA rAlnOewenpcc m rd edldAiacs Blpyo5l taIcesleu2eiMNthblM2a em1pocSmvsdaR M tdr12 de2eeo eteDBSa6m6Afa en9Arr3ebdg9Ari dn1eudunAi m sIv9euee d9R9Irliet 5m1rN te0Rsitt vsate95n9etee5aCkT5tdmeK80dedhgKNop5rb5sdiSe rnwPceu E lasfEaM9EeeEianurwPMilpnTtirdmc5tTReauheivohopindssenrrpiPSwgidftPth cr2eeaireltaRraaFiiRcso4onwwnsontsIogadIs uoriCa 9munbCrbStmjuieeioE5snnuEctop dtiaaneutpnordrnetcdcaatodhyrodaokwnisGfegcadeihret uamhedcvermaybet s oOpzopuztlatirory enl la AMPVHnFeWeeSadaGpBgaCprCmerPCpetmaTaheThslOelh tochwneaeteaSrHenevorAidikEserTosneEOeeaernWoiEdgnshWanOeAExrsuHEuOgaeEgdUO ntegissmnOOgsEgtrrmigsrE aOghtCaedOggROmm ehgP gSeShmsgP BmlOmOM eereelBB MaEe seEeO oeCa rmlAel teue CaueetpAt vlc hBElARtl esensMcesthetG REep oeAonett aeatydholeSt egetEel Vtnyeen MtogtEcdren egSearSe F t sySoPEneG E Soes tscL eHte WeAeoWW eeH n HSydte ODh trya m Epl aO Atav Da O ieSClrOhi my tBApe te mO s nmAh T rlihh W HPnETe etrd m n K Oee MB4ToeY 5eraW S OT i SA Oes eomIa ro p ma6W A5Eop 5 o r rTsa uak p Pn pgS0Fa 0ia i 5d zOSeS nuf rfc eOse eHrN aIs z 0ta flAd A naais ao nCA aTrlAOt mum se Ada siucCdAn hr O nost7r H H f edegesD hO dTdh oaayn5M Cr RV OSlaoe l d onieg AR cl O A hEecS agpT n 2 eiiE Ste e i AncePono gneB ttepb iTMa C O doyaey eengm ey nPe eaS t O lPHMhnl sl t eyrOEsaBd c OB i1a a fe a C eas a tESM o n BrtA fbrMW Ae tth9 so e g eitFn 2R Ml r5 seh Ti mC e aD gM aueeA i eo E R tO A hkE eksa e h as Eg u 1f en f h6 a k I r aeM s a gN 2f ie i rfE t 0 Lfi c2tsr o ssa oW s 0Ev 5tBn a n t S P s o e e g D M e n2 sEM t o m I L d g a M T t P e s e s aS Ec o W T a a H a e t h wv o DnH tT ta e e iTc o t s Or 3 s a EmI s 1 c kEA 0 C 1 Eh eG 9 e 0 o5 S s9 G F 5 9G S 0 i 8 9 H 7 rc 0 T 5 6 5G5 2i 6 S 5e e0 8 9 0 T7 9 06 F s5 5S E o 55T Hr5A 05 7 0Af e0 H 06 D5tTnEnS94o C T9c5EWd5D HAawA9a5hA0PPs5dndEPSAoHd2tlTCEdaAa dTrodhAiSEFditiaAndRAEJmaonoBCdgAhilBndaFsSrlnpAGNBdglreFoWntOaultnSMyutpAuCsL rayrGSACmAeRrTEGtstea Ae2aBBnhSneaatbEdhiBnSS dSfoKbwaCbyodaoOhacrBlfledeylrntaeecScdnwockbeBarHaeMPTdPSVuarkBAoraro2 eccaAOrriaaittt kOBtlFrnenEyWe ark ok a1PPhsnn ffeSrH5ys racafentTLPh RyacFayFa0oatihe ok0ksd tBaO rranankws aOPhoBftnee2 HCcFOncakfcrrtS nmaMenar nneBkehRoScasa MBfepdn ycsciaetsi laakkeaBRBeaipa lctEhhknW te aeFMeknuafk ounu aMPfa arrPne ssNaTTsaf tp tatkeieE aac todsoeattan es penne e an sTh aaaA sn g at a es a crr tt c si N sc esMI tmm s d s h M aa t t NPa e OF A i i k neO w 3Tk l l e2 k C k e rES ndao e r A ia sF tdStaa Ps P S H ht su t aa H H8 t ro N t hrc L nn a ola 5 oe l c c w a m 0 w l aE a C l n T b a e b kk d e n eee SFa O r A d srs rr i r a s i i i e e iee A sK ss s e S 1 a sS E 4 u a c 9u T S 5e c e 8 5 1 1 0 4 0 9 9 7 9 8 56 9 5 9 8 9 7 95 8 5 6 5 7 5 5 5 9 9 09 7 59 79 5 75 75 5 97 9 7 9 7 5 95 695 79559 5 55 555000 APPETIZERS NEW ENGLAND CLAM CHOWDER CUP 4 50 BOWL 6 00 TONY ANhoDmeVmAaLde SbluCeObeCrrOyNdipUpTingSsHauRcIeMP 9 95 SHerOveMdEwiMth AouDr EowPnOcrTeAamTyOsmCoHkeIdPoSnio6n 9di5p Smoked anAd sNeGrvEedLa sSisW oIrNtoGssSed8w 9ith5BBQ sauce Juicy chBicUkeFSnFetreAvneLddeOarsloCfnrgHiesdIidCaenKbdlEetouNscshFeedIeNinseGadEsrpeRiscSsyinb8gu f9fa5lo sauce SAFlUatosTmh afrtEioe DdlesmAhaoRlnloTbtIsuC toteHlirvOaenKtdaEpheSenrab9ds e9 5 JfurcemrsabhbBohslAehuremKbllpsEaafnDrneddsSphsaTecirarUeasdobFnwwFiniitEtghhDbwtahaCkesepaRdebAari fnteBadcrtts8aear rm9svoae5uudncinteo af CHHomICemKwaiEtdheNacghPuicOakvTeanSdpiTpoptIisCntgiKcskEaeuRrsc Sese8rv 9ed5 NY sptoriiSnptIgsRrwilLlietOhd ftIroNepsheBrtfRoemcUtaiSotonC bsHrluicEsecTdhT eatAtnad8YsU e9Mt 5oMnYt oast FreshSlfyPripeIrdCe pYTaorsCesdRedcIawSlaiPtmhYasrpFiicdRyuIspEteepDdpienCrssAe acLsaAopneMersdA flaRonIudr9 baa n9sdi5l deep JMAN8 004 Dinner Menu_8 5x14 indd 2 HAND CUT FRIES TossweCdithUwaiBthcArCeNuabmaFynRcsiIplaEicnSetrso9asn a9du5sceerved NT oEp peCdLwAithMhoCmHemOaWdeDcAlamFRchIoEwSde1r 2 00 PulledbpaoDcroOkn CpjaeKlpappFeerRnjoaIscEkaSncdhe1sdc2da al0lrio0cnhseese PepGpeyEorTujenlIleyN vbeMar ckYonneBwanEydoLucLrneYeaemFdecRdhIeiEnesSyeou1cro2lmi fe0b o0that TRUFFLED PARMESAN ROSEMARY Parmesan cheese FRIES 9 95 fresh rosemary and a touch of truffle oil SAL ADS ADD GRILLED CHICKEN 4 95 GRILLED SHRIMP 5 6 95 COBB SALAD XX XX Discription discription discription WeBdgaecoOnCf IOLcneAiboSenr SgAILnCedttHWucoemE eDFmrGeasEdheGSBaAlredLueCAnhTDeoem8sae t9oD5 rCesrusminbgled RMOixAedSGTreEeDnsB CREroeEaasTmteyd CBiGleaenOttsrAo GTRoaCantcHChhEDeEreesSsesEAinnSgdAALHAomDe9m a9d5e SANDWICHES Cooked SERVED WITH SOUTH CAROLINA LowPAnUIndLBSLlboqEwSDIanuPOcOuerRSSeKmrvoeSkdeArONFnoDAr AWBbrIiooCuctHh1e49RHo o9llu5rs Smothered FRIES Half PWoiuthndACmBLuerrASgiceeSarrSnvCeCIodChoOekeenBdsAUeT BoRLreYGioottcuEuhrcReLeiRkA9ionn lg9dl 5TAonmdaTtoo pped HOUSE SMOKED TURKEY BaScmoSnomkSoetrkdiepBFdsoRLTr ue6ErttHkAueocSyuerBTs r eSHTaoAasmntNdaWtDCoita WhSrvCeIerrCdavneHTbdeenO9rdrn ey9ArC5AhBnurditonJceuhyi ecyRoll FCRriIsEpyDBaHttAerDedDFOisCh KFileSt ALeNttDucWe AICndHTo1m1a t9o5 Served On A Brioche Roll With Fries SCALLOP ROLL 14 95 CLAM ROLL 16 95 SHRIMP ROLL 13 95 CYoHuIr CChKaonEicdNeSOwCfiGsOsrRiCllehDdeOeOsNreF rBSieeLdrvECehUdicOkSneAnANBBrDreioaWcshtI eCSRlHioclel1d 0H a9m5 YofaulroCShaouiccBeeU OAFfnGFdrABillleLeduOOCrChFeHrOeiesnIedCACCKBrhuEircmioNkbcelhneSesBA RrLeoNealltDstut WcTeoIAsCsneHddTW9om i9tah5toS pSiceyrvBeudf OfHPiAnGeWraipllAepdlIeIBAABnNQdSCACehrSHivcleikcIdeCenOOKnBfErAPeNraBosrvtSiooTlAcoohpnNepee DRLdoWelWlttIuiCtcheHAASn1ldi0cTe o9m5ato Half Pounpde rBJuarcgRkeOrCBhUelaSTecesEkerev 1enAde2ndod9nTDoBarpizUpBzerlRiedodGcWhWEietihRtRhBoS1allr c1iro an9c 5hAaFMrieadyoEgg Pep Selection Will VVaEryG APNlea sBe UAsRkGSeErvRe r 10 95 For Daily Vegan Option Fresh handFbIaSttHereAdNfriDedChaHdIdPocSk 15 95 and hand cut fries HAYWARD S FAMOUS FRIED CLAMS A MUST MARKET HAVE Fresh PRICE Ipswich fried clams GRILLED OR FRIED SHRIMP 16 95 PAN SEARED OR FRIED SEA SCALLOPS Tender aMnAd sRwKeEetTlaPrgRe IsCeaEscallops FRIED SEAFOOD COMBINATION HaddockM SAcRalKlopEsT SPhrRimIpCaEnd Clams BBOQurPoUwnLsLmOEnoDikoendPs BO BRQCKPheuQdlledUdaErpCSohrAkeeDwsiIetLh PLeApp er9s 95 Certi cate Number ______________ 10 C 3PBH Wa1IBrHtEa8ToienHCamoncoimmatT1ogomgoah1esSwdcteeEl lns3IdoieiiRCEROlnRG7osat Fom dIrGCAhi InaSkGrRbe EiWSMeci eaGtae MSAagBmdaH Hrdu SshmtgCe ameFeuae siBs adcHtBle fsaaoeC MfieloaW a Ahelgr hWtnnrn e neu eW 3eie B p nte f iseo hdfi 5tEt h deL uh s i i0n N r nieC icl e vnt c M r eWateh E ky t dtT oD TiT iO slw ri t wkw I D ec a h Cr a o w e ao o T f F o 2r P o o r P P k o T ru o fP d o ow u R i a H taa a n s y o c td c o c h e t h e ehP mi h e rS e l e leo fice d d d a so O I F h oE c E E rr D k ogh g i ge H er ge d g g e s a s d E s s g o m o g o E r o o sr n cg S n n m ao g a na a a s P t y T a T T oa oi i o no n nn a c a a oK c s r a s r s e a t t Sm t ae T k e e I s a do e E d d e D y a E yo R Ec E s o n or n nt Su V ng e F g g r t B ld r a lE r li i e isi i s s sn E B hD n k h h E n u c o M n g M M fh W dR l N f uie o u T us r fo 3 oI 4 fhf fiE c2 dfi 2fiT 1a5E 2on5 1M nbn9 4s09 o2H09 o5 5 A P5 tk5 5u9r0D 9SeC0nr5fS5diHpeafimAKMeiiTnninIRnllOFerlhlCgae LnC CavmooSeCraFCraeMdRMTeecrrouCaelmshersiaaedidhnastnongibTAoiEn inaal uesnBtkfbew ecaanblHfiBaleseet tSoB idJeFie SsapJe nHtrp eel m iura hevra sula RrAr ao Hyec isc h tyi ncTtC l riUlce el o eaaI la e O ahb eBln n EgOnas lM ey nodr e p s da r eHSa sdlii wpia ifccf tl nS oa ratyk in oeiis Hegr ocBnlio g elsn euce g eoao d ee oss t h ln fca euJ o lE sah J aSdB bk nuu va Sune ja aL baeeei r dVc id ergiuj cc cd ecs i e eatmt crc eoeeo atI ioter Eon scoo tcfA St a A eorMen hoid ap n2 d acpR eSaar u p h 9md pr s aTS cla5 Hs eele Ce uneA aea d o o g a cc u i On lec h e l s s G aau r u a l s a n m c eg n d o t iEe t n ga n s g ed i S s irS t a aCe i o l w e r n S es s o a a T r ua m u x c n 2 e d 3 e 1 5 2 2r 0 22 05 05 65 022 90 0 95959 9 95 5 955050 JMAN8 004 Breakfast Menu_8 5x14 indd 1 Date _____________ 10 3 18 11 40 AM To ____________________________________________________________________________________________ Amount __________________________________________________________________________________________ Signature _________________________________________________________________________ BreCadHcehIdeCeasKnedEaDNnedePmpAafrriRiendMarCaIhGsicaIkuAecnNe BASreeSarvsAet dNtooDpnpWaedBICrwioiHtchh me 9oRzo z9lal5rella PulleOdnPAor1k 2 BPPaocuBonn d BJJauBlragUpeerR nSoGesrE vARendd1OP2ne Ap9pB5errioJcahcek Cheese Roll CHICCKheEdNdGarriAlCleNhdeDCehsCeicaHkenEnd EwaSitBhElaPcQekpUPpeeErpsSp eAOrnDAioiIonLlsiL saAuc e9 95 CHCEhEedSdEarQanUdEMSoAzzDarIeLllaLCAhee s7e 95 MusChhroeodmAdasDr CDFhrieOeedNsOenO iSoPwnTsisI sOJCaNhlaeSpees neo1 s P0 rBo0vluoEeloACnhCeeCHehseee sBeacon Pan Fried Egg Peppers Onion JMAN8 004Dock125GiftCert 9x4 _ 25 indd 1 WORK NOT PICTURED 5 29 18 2 13 PM Items indicaTtehderaereissaerpvlaetdesrsaepwaliftootiorndug ncsdhheearlrlcgfioesohokfoe rd2e go95gr sc omMnateayaiinlnsco rremBaaseeyvecyrooaungrtearsiinsakureonfdsfeuorbocjdeocbotoktreondeMinialglsnrseeasdcsieh neutssspe etAtcslilaSblaleyleeifsf iysToacuxo ho akvAeedllctmoeerotnarudineitrme mCeodsnicasanuldmcpionrnigcderitasiowsnuosb rjeucntdteor change cooked meat poultry WEBSITE WWW DOCK125 COM JMAN8 004 Lunch Menu_8 5x14 indd 1 10 3 18 11 48 AM

PNROEWVERNETDINUGCEPEYSOTUIRNFEENSETRAGTYIOBNILCLASN HOF7 001HoffmanExterminating_4x9 FINAL pdf 1 2 27 18 4 21 PM Quality Service With Personalized Care O PHUEeRpPFIlASefpePirmyrTmssIeRoStouaOKCHIurnynYeFaneoOhfznueEetoOcNatusopSomUrsstmTfSdaoeoBRIRfstlInnouiiuOsoerstOHgtiyNnunoa LsnolbOAWatsleOtL Meuit ohpucwInaENaEtthtonSN ipUl cmer PEuoP A caE rvRorkinCedTneGndeTsOPyRteEYIporsCrOonoeuvCtooeasNpSirnfntUrmehgTgdcLEroRAyaoeefmVVrnonaRHNdeAeterkrsnoEtroLDsm gltlNeUwIiyAolans aAernT eRtdToioDfEsfneaSSrv e Quwaliwty wSe rhvicoefWfmithaPnerpsoensaltiz ecdoCmare HOF7 001HoffmanExterminating_4x9 FINAL pdf 2 2 27 18 4 21 PM SIGNATURE COMMERCIAL SERVICE WeaH nHhEFdaaooAnvfwofdemLdecPTa aPsoFHnRrleSnaoo rcts mnOcvihngeihFicToulsaRyleOo eisEsseloismsOMtnCsbwtgioaaeDudTonf nnelFeIe tgsdynAaniNSd arAnctdDoHiutiGniadaiiwNplaosfinlfbteyumfeidDmPiicuresenraaisseoMdaUnnCriPnprn geyacBokteesRoremHCmriksLmnat oeOsesmodtImamte WCrsuPseleditpsearnh EtclrrcerceiCRieaxeihaaelsT1olrsae9uYicnn9su Fdce0salsutcodimliinteiger ss gwuahriOlaeunroteiunebrnduposrtvoionatgeteisevcsettiroipisndeassoltewfcryavooyincusterrpsoirnlmossteaeeckrcvtetiepcsdreuo rbiseleymousr cizHpuhnferroaFaeedrfcrveefpoiecmdnlamio tthraymOepanfoauenma sonsrdeftddclerirceanxcppoetngirrean coontlntucivhrmsoesioefdiatvsplhoemcespramiioyrlnoscivooitssglzeigiulteeeerfysncawaaop otcmiuWrmitlpelih risretsmIotsianeegwesonsfarrhnirtavldteoalmioadewctbiniehoetsetd inehovhtataanhohaltl etfpuehfHhpaiemtocotyxsifawpooftyrmonseeowtruavoifseeinrafspn csyicsectipoalcewyiuentioaicrwielulil sferi c A partner you can cvount on South Jersey 865069 466583 09168535 Pwenwnswylv hanoifaf man4p8e4s 4t 3c1o 1m032H O b pF qdeerFuonioMnavisnglAiuidgtNrtyiihntn hSesggereHBeerorvnEOufiigdoErcFhrlleaeiFteocswMvtustheirioitoAsnhcnpgNiusnppsa oemt Snr oratsdmuCokndeneOioratesiRileniv zsEgeteertdiVayotomAcrbniagLeearheUntpthdEreoScubodemsmt unity CriOdOuoNrfFmiTynWaoabnmIuNkuoEirevslOyUaiiCsnnAtFooEuesivwmRresDeeOscnmEtpeysUEeepodinPrsurRXcaoctrRinbecaPbNdlole1OuAnaom9sOUtnpiN9rnsdReo0D eSrlRwsTaasIsentTHheOesdiriOdslivFNedc iaecIoHoAlEnenwWuottNLfriiaisfanmpIyDNlugTsrmaoeuOHpnOtsaaer rUrsotcFaTkotthnNeeFiHgoattceIsCrnstECoe esEbwddEeeO trie OonvPnigUcEieenRtsNING South Jersey Quality Service With PersonalizedwCawrew hoffmPaennpnessytl vcaonmia 680596 645638 90615853 484 431 1032 Quality Service South Jersey With Personalized Care 680596 645638 90615853 www hoffmanpest com Pennsylvania 484 431 1032 GRAPHIC DESIGN BY JESTER GRAPHIX WWW JESTERGRAPHIX NET

Maxfiomrizvinagcaetnijoonyhmoemnet and income owners ismTvaahaagiestncrMeaceaffaceataegisoenrmoetnksnemaeedsalhntestiirnotnnoegsTmtgcr thsooiudseytamwrreoentarauie esnsnlir nsingnwebfpttuagnuotrhrlloot sawaeprta vimriseImsetetehrl oysetcwiuyogn oa suceudnpgoetudpcrinrsemsroejstotpoasmreubabytmaarce wsinboPnieinadmlrngygygo cmmrpktoteoneaielntlrsoenemttkwaayctselrt ninntg TiehsxecpoteemraiemmnpictarteotepKdweetirlotltheyprormWuoarviilnfdluiaailnglm gessmeorRwevenincateelptryvsroaJagecrnarastoeimo ywn Sorhreronierteasl Let us take the weight o your shoulders KW7 003 HOMEOWNERS BROCHURE indd 1 Wteolsoeorkvfinogrwyoaur d KW7 002 KELLER_WILLIAMS_RENTAL_OSPC indd 1 hRaepapsyovnasctaotjiooninhooumrefoawmily of ACCESSIBILITY ners CON VQa 2nUEW4bd NA y elW7o oaIL EacuuliWIsrtNTkWsRhoecWeiY CWoEane tEoeuEp nhgAeA ur ttreCte hWLsrAo5Shs tPsheehov AnmcoeSEr3oeImeniereecnrE1dlUSceec oCvlpwtta swe ykrieo1oReTeuo avtli 7nl lcgnaAlaeygOAnerlaoLyeaebornehldWwTfltcNiayocnolDulko1vdluaaiEWtyuntiCerss2epeeslcElwyurhela heEudeSsfy0atoOxyprralbiniuri5oplgcEieutogna cccssnohfeduorneRuarPhloouiioeisPleremnttdntrr mMieVksiaetopcqpcaaeetrapislIdaiheroneyurltCnt eatCoaleensagaeaVslagtEtgphiihntlscitllllitsgiaSrteealseags atdtaioeulayaivrdrkt uttnleeethaed reemetayKagmmenMsnoesesmlpvnWttalinmnpgoetaaosaaotkcsaauunnJslswnietienh lrennaatettradkaseoeshsuirtltbsbnesnrtsclliuptgosylenCttskdeaeosrfusqaoa oovyafietaorunnanwpaeSoldsvuildineehrrltnaaycaraiessrdoseoeniotbpnvleatrysarudrnleordeeaenbsoatnacRgs abdtlDvsuenhaouecoesidedtenslttnoneeao iccafsktsymtaookmlatiasonoo rrvvelmnuoiasndneaybnsrur rselocutckwigtsnnauteoueetetrtmiseirognsanugtleslrpesp2rntr4osot gas7rlparemactetisve PoAwn atetrarcftKivWfue opJluelasrrnemsrn yeifnaryigoeSrnahudkvolyarrcewaeptetRiboerinnpnroetegaaspselypne sc erecortthmafytomarkems ance crWaeSm eebapuorasocieEbkghmaneleaanmsanusn gatdrieleiimirlnetMmaeaninrdcaiagunesretrt skeetaekitrncnotDfeiagadnistncggceeieciancxtaesmutgnalealradpnelnatasdisrMnoiieovgsndsceanpseisaosrSra tlnvkoancmastocdetoieiostirotadtpeaininiceldrasgarg lMaeclinthtaiekvnasdsepna ielnwapycesaeilifysbsi cs tpoiteer lcinlikcsk From postcards property in ttohempuaDltlmiiprleoe fcpotaugMrecaubisrlotocmhuerress hwanedpsu t your KW7 003 HOMEOWNERS BROCHURE indd 2 Ask about your Airbnb Integration About Us lerveenl tovaaflccrOhaueuitvsgoiretohuoonnlmrywiusr geenemuarnewKeolsrtoesathesictllvirelslaivaeenrlritrvlcdeheyiWetucda uoesnairawtldnnrlrneilnyidadinp nemgqOregdeuuxystsaapreheRnlegaeintderroytibaeaaaourlntlfpetitscivyeensyeerrtJtadwaseyotlearoiempnsarrdrekeraao c yxwlpOloiSemfemuarhlrilctpz oiseetaerrutsnaesypyikoneo eurefeirdop r A Sunsational Summer Starts Here yYPoPoiuaucinrmlsitcaaanklnuesdnamcsthahtedhoseeveafblansedd aeSct aihdbneuwdptcioltalhoslealtsltmertesefaoamsrnueodvrreeisesre s ashells 5 31 17 12 05 PM 5 30 17 11 14HAtIhMKutV ersWirspytihteJ eerofrubererescsbsteetrvryavapnaScladtahic otenionoetsnrowearseRrweeneaetfrabinlcllsihttnihta gecils osusmp ucpqmoaummriecek ral ynfdorbtohoekseason KW7 002 KELLER_WILLIAMS_RENTAL_OSPC indd 2 5 30 17 11 14 AM

E xperienceTheGrand com 609 522 1400 Vacation E xperienceTheGrand com VACATION RENTAL SERVICES PROGRAM PEACE OF MIND FOR YOUR INVESTMENT EXPERIENCETHEGRAND COM 609 522 1400 KW7 001 GrandRental Booklet 16Page final indd 2 3 KW7 001 GrandRental Booklet 16Page final indd 16 TABLEOFCONTENT 6 8 17 3 45 PM KW7 001 GrandRental Booklet 16Page final indd 1 If you own or are in the process of purchasing a vacation property at the prestigious Grand at Diamond Beach and need a professional company to care for and rent your property in your absence look no further The Oceanside Realty Team at KW is ready to serve you with Experience the Grand our full service vacation rental property services program We are here to make your life easier while helping your residence reach its maximum income potential 6 8 17 3 44 PM All inclusive vacation rental SERVICES EfyvuxoalplucyearrrtvieieaonncntcaryeteioontuhntraehlvGoathrmcaeanetwdoiowanisynhayeoorcmunoemewe apadnlsset t weOweuvhlralicglaeaostdaieoelnnliissvrueteorrneinptaygrolopvpuierrdoregspoueyneortasuytliswzseehidtrahvvsiaceeercavsoilcpsuetrx oueagrnrieoadcumctsiav drseeetsr aeingsdnse sfdtrreeteoamvmalicinnaiemtidoiznseo WltuheteioaenretooratmoreanqneuasigrteiondpgtsoyhosouuprcGfcoerrasnasdl l AC C EWSWWWSeeeeIBhaafaarIreLecvieIaltTihvtaYaeatdieplaeogbdiunliecetastototefcdychooseuntcataakn cisdtnpfyoeaorcnuiydfrioccguahurleleygcsufktoe sros2Tut4sht ehsooGuryraosnuadndaeatvyDe ir7ahmdaaovynesdtaoBwdeeaeacelhkwith day to day questions RE A LWWWWEWWWeSeeeeeeTceciaApncosrcrToetnteeatalEdilpgvbetueaerSlciacrlstEayettheaRacpalcynlVuulolodsrIirmsuCneteourpiEnptmeoriSteaeasiatlznliilettaltaisadvnlg eledrrpaheemrdaoneonsmatmpsnraeekeuanrenanitdntytldstaipionnnfreqfoodoeuuprssiermreiarpeaatnrsystodiooavndnseaisnsbletimvrsniasbdacmueraktreteeinotttinhnsegrmepnrotoangl rrtaoamtyeosu MA INTWWWEeeeNhddAaooNvaaeCvEwaidapelrkoo ftewhsrasolikuognthharloacuftleegarhneaivnfetgerrycercealewcahnoginnugseistpetrosetcvaeeysrysanSdatsuhradraey in season it with you QU A LIWWWWTWWeYeeeeestArcchpceooSorrsonenroSoveddlUviunuudeRgccefohatAtyrllsiNlyonphiussCeoigpsntEwuhefcoce ihtqrsthceiuoeacdankealsiesttlalcyatriotnlteieendandngsttaasamgnlukuorteruseenilstneyhtsvosleyuanronthwdoornrymeegarefustielstaartmtieeovamneinserytnatcisnheedckto oouutr high standards KW7 001 GrandRental Booklet 16Page final indd 4 5 6 8 17 3 44 PM Four unique ways we wow your guests Egwvuielelrsybtoesnamereoernnejooliykesexclbyeetpiontigroentfre eWrabteeumdsilnaikkeeesstyhoaeunyrd rveriesitmiutorprnosrtfoteaeynlotluiakrnerdeVsyIPiodsue rnscoethineythe future WELCOME GIFTS To start their vacation o right your guests will arrive to find a personalized welcome note some delectable delights and a local area guide SIrtiP vsaAnl otQhtUojusAseLtfIaoTbuYonuBdtAifniTrsH5t siAmtaMprErheNostsIeTiolIsEnwsS iiltl sbeabaowuatitcinregaytionugrlagsuteinsgtso nes Although it is rare in the rental business spa quality toiletries that PEPAwDvmElOeteoRhaSr evoSykTseeuOgisgfVtuNohatIeuaASsnidktLItdeiTwiAsetwTooTrcHuoeTaclrnAdEloklceNnNbtedovKeTeidnmIreYOutataOrNhasiknUeiesegagrgttutuihoseeefssisietertdensfextdcapeuyalesnsrttiopoeeemnmmcceaiaearki llie rnewYtssooueuuralsetiebrntenehgtdtue irnAarnetchscEoaiudxmnpsedtepno rocwmieuerennietrcdt xeeicnnetghenesdoastGelertah3snetaidorn e5dwxdmepaeotyhcrstienaapktfitorieotnr fssiytw oaunordrtghtouieta sntWsdweeepbraearlitnesyv eTqhutaiseksiisntiogonntsheetohtfeimtyheemtmiogohpstathymaavetetae nnitniognfutlowthaeyssmallest of details KW7 001 GrandRental Booklet 16Page final indd 6 7 Interior Design 2030 KW7 001 GrandRental Booklet 16Page final indd 10 11 ExperienceTheGrand com GUEST FRIENDLY In addition to ranking first on Google search results our dedicated website provides a refreshingly easy booking experience designed to convert ca sual inquiries into actual reservations Guests can further personalize their stay by opting for such as mid stay additional upgrades cleanings and linen service OWNER FRIENDLY A special owner s portal enables you to log in anytime anywhere to see which weeks have been rented or block out specific weeks when your residence is being used by you your friends or family Powerful marketing performance for your property Wtvoahckoaeteiisopnbyeeortuster rHvpaeocreasitatiioroennsehodommtoeeombfaothrokekeewtdya oyWuserwvmeaacgianetttioayninouharonrmdesemidtaheranknceetthtnoeoatOincceeedas ntasbidlieshReedacltuysTteoammerabtaKseelleorf tWhoilluiasmansd sWoef gliuveeshtserwe hwoeofktennowrettuhrensthooDreiarmeaolnedsBtaeteacmhayrekaert aaftnedr we work hard year as repeat DEorexnEspDetehrIrCevieaiArntTicpoEeenDtr hsWoeEGnhXarePaltnhEpdeRre rcIfEuoeNsmreinCnigsEceaaTsnHd aevEtisterkGwatocRetpAdiv Nteian DbutelseWreitorEo rfrBrpimeShnIooTdtboEliyglerwadepebhvsipcraeen sodeunsrclgieduetehssahttsomhwaaskv eecshbpeelcaeknnenadibnrlgeatateovsagacenatdttihoaenvaienialfasobyrm ilLitaayts iotayncectaherse tsyhenodeuaesradenatdosmbooafpopkse tolhepealerpnseeerdfaermccthoperredoafpoberoratuyGtfrotahrnetdhaevriearacvaiastiniotd n rental based booked their DOeonuInGgrgIifonToiAecnuLginssMtoetrnrAafaRtmecKgaeEyrskTtaeoIntNildneGgvseptrhoarngoseuogdrehigdtithlaienl kminsat eprrkaneyet itnphgearc schplaircnoknvceeanlsmttoopabmiegantxhsiem rmiezteoasrtght eeetirneegncttciavalemomfpyeaodiugiurnmsre scfoiodroerpneecareca htiivnegwceobnssiutemleinrsksp lbaannnninegr vacation ads and etrxatveenlsaivteThsetaGtisratincdalaatnDailaymsiosnadreBaelal cpha rSt eoaf rocuhr 6 8 17 3 44 PM EMAIL MARKETING We use email marketing to reach potential and repeat guests at the right time to secure their reservation SWtaOergCceIoAtmaLmsMpueEncDiicfIiaActeaPudRdaEiielSynEcwNeitCwhEiothuragsueetsptrsovmiaotsioonc ial media channels We maintain a fun and interactive social media presence that can help re book last minute cancellations and DIRECT MAIL Let s not forget about hands These pieces tangible not only dpirroemctpmt tahilepoiericgeinsa Wl rheceethiveerritt os a postcard book their voarcmatuioltnip ltehepyagaerebarolscohufrreeq udeirnetclyt mpaasilspeidecaelosnagllotownueswtoppoutetnatilaitlegraulersetms inder in the palm of our customers OWrtehNevaiGtcedlOwoaIsrtNeeelGsnytoamAnlNoraanAticeLtoasYrl SeatnhInSdedarmreavoernenituaoerpisentradistuuhssatrboylfeteraeasncshdesattnaodnadecvaherieeryvsertertashtiedegehniicgchweeiistnhtopruaortsepssirboalgenrdraempvre oWnmueoeatfiodorjnuysso tWurraetreeressisidfpenonencededqeaudt iT chpkaelyyGacrnalodnsdep rWaotfteeesmnstaiioonnnaagtloleyo euarcchormespideteintocre sassailfeist and marketing activities were our own We realize KW7 001 GrandRental Booklet 16Page final indd 8 9 6 8 17 3 44 PM ABOUT US ERooxeuwparneltrceyioremnTsecepaeramvntihcyaeetiGrseKrpaecrnloleedmsreipsWnritasaileltdiidavemedosisfc wawLtieotehdclla edtlxrliyavp iiesnoriweoiednnn ecohdefigtaihnhnelydaO lmlocfpeoaaectinrevasattsitededoed f vacation rental industry Wbtdtroooeoeonmpaktmraaenolkdyavenpiaodartnfeohgdtpeethheremereetabivoheduesisygsrt yhyfrwoeewravhsgsetoicpunrlhekeeuvcseiewnttslfvirolootolofflmvkceekeunedeysjeopotwpouyiomri ntOuhrgeerurmnrgystgaoaueonulreavarswilgtcsiivitesnahrgtcaoeoanutiutetdti rnohnWqnaaiubnevalrgieenslinttgyyrytoieavtuoaoelrf after year Interior Design 2030 6 8 17 3 44 PM Interior Design 2030 6 8 17 3 44 PM Interior Design 2030 KW7 001 GrandRental Booklet 16Page final indd 14 15 Hear from our happy homeowners See what someDkeoeurftyrTyishnoetgowGtsrhnauneecdrpcs se ahassonstm dnTeihorneweesnirpyeloeresanaarsdrsieev serthsanyheeinispOgscianteboaothunvetasocipduarreotvipoRacenearsattilyortenymqrTeuaenneatasamltgspear omItphKeeirengtylthlesilnyerrdWvrueiciscelltosiramypmrimossgearhantmtadrsibKdueetlemledrotnWosaitlrtlitaaetmnedtsiotanhsatotyoeduxeprtaetriruli estnitmecdeelpayrncodopmeprrmtoyfuemnDsisaicainaonatnigeoaenliPmswomenitnhattorpetreriotaehpmreo Wcpahrceoihefeiwveesvosdeuiodilndnaasnlluiidkscemocefttasoensnfdoueltxlheycroerreeomnduateginndhyg nWeaaesncsdcwowcolaahudrlidlieenshgpigrftooohrvliyoTdhurineercgcoOotmhnceedmaoleanuntsendisditttertauetRscTtehihnaneglotyGltohrgTaeeimncadamfloearaanyctdohuKmsreuaslmlruekmrmetmeWinreigslrleitaroaemosnolstsantl fsooTrahanestdhsyueahrsaeosvtuuehtrasicnttoagonnutddhruiengcgbtoeeadrslsettshcfouearlmrtesresanetnhltvadeelysrse vwwseueitlrathes for your investment Jack Carol Cornacchio If you re looking for Whether you re new to market our professiona the best vacation lism and a no ob lrvioegaunacrttaaiptolirsnoo nvoaersrnesyneotstruaas lcmrekperarnoetpscoeeoafrrtsdyyo onsGueerivrdpverivcoueepsts earyptocryuoa glWlllraetloomcdvaaefnoyo rtauytwro6aiun0irt 9dvt oae5cp2mat2hte i1eok4tnn0yo0rowefunloe tradalg you ve found us e of the Jersey Sh free consultation ore and KW7 001 GrandRental Booklet 16Page final indd 12 13 6 8 17 3 45 PM 6 8 17 3 44 PM

LETCO9 002 OTR PC indd 1 WT3LTT1IIHICWTC9IKTKSCWELEEATET VLSLSEIEATNG NTB1OGTL2RWE IHEESGGEAAEBZGVRNYEATBEOHIWROLCEAA RAALB TYBCLARROELDEIEMONCMHONGMI S LCYNUISONOIJNOMEU0INRAT8 TY0ON8WCO7ENRNECTSUEESRRHVIEODNS EDAITDINWGE DMOEONRTSIOONPEFRNE3E0CMOIFNFUEET ES PRIOR TO SHOWTIME 5 20 19 12 05 PM LETCO9 002 OTR PC indd 2 LiSttelaeVCEicgutgroeHrMiaaSrotEbvTdoidhnryegTr foeIrwnsocanm ss hJCiapJhnSeu efr fsPcRrhCeoEyubtiVnaCrweSeaIclAyhainllLdingTHAAGNt laMKnatCitScthhCueorwTcuhnDOtoiyxfo HtnhaeabtiHtJaoetlysftoSerprHiGruirtmapahniixty 5 20 19 12 05 PM LETCO OFFICERS President Vice President Artistic Directors Secretary Treasurer Board of Trustees Jim Henry Julie Shutz Tara Dixon Kevin Berdini Mary Henry Tonya Neuweiler Aline Ellen Bernstein Rose Faiss Voorhees Trish O Neill For omnoFreacinefbooromkaattioLnitotlnefEugtugrTehperaotdruecCtioonors saeuedoitnieonosf or to volunteer join us after the show us ANLNDEOTTBVCHYEOEMANW GBAETILTRHLHE15ARR EEC16THWU RREI1SN7RT EW 2IE0NIT1O9HNE ThetirLhEMseuiTrapCoyhpOofeorLlgrpBititvwtaiselreistbwhEaaagrtrvhagmeiJsHrlyoyaarnrsCebpdrcoeefercauiTivtaaouelnwdrTdenaHtpsnhArhdeoNipdaCKupfoocYpurtOrnieoUccniiltsao ted IpcgTnroathoemnecrimezfLaaeiutitdttnihlsoeitniFEyso wgdaoghondTondPshageateievnamedttrrbitsyeoas CcaiHokolanotmbocipistathaaltenoct cyofeoom nrmLtmHEemurTutunCmaniOitaniyt n yoiei strAnyga prai5ocn0rhitz1it aohctnei oo3cnfnuesolautncucphrhersoahofisofttwtohh rese LETCO9 003_OTRProgramBook 11x8 5 indd 1 6 12 19 1 30 PM

PhilaDPdaOewlBpnoh sxiaP4 l8Pa2Ac5e319144 opwtrrhciaoogseocnvDrehrlokidlrtdaasmssviwbeingtmacorognevnere isanidshcmrtecoeitporhiusaarntes PooltsiVilnvmn asieggscBeowi etxtsehtputoucrearaemsaeulxluapeivmtvseterrneeoeaxwn samptwrwicoloeeortefnwcaiifvtw oioba esavroetilpimnehymlouigroenbyeomvlnfeis secdCaetuftrowSorhpavpmrEapapidoc toerpaleeirsCecawtsntdSsyni ecnEdbvs rovoysieisr icwotfgosaolaoerttrmihnmavaorcibtenooeunraulai aslsgnDtekthidroaafanbwoifcnyrfenooeiCnd fmscpgSuhtrPmecEoualda vumanibtncddiayoieitnnnybg y YoIun vrieted R S V P Finding Her Voice DWN9 003FindingHerVoiceEnv 9x6 indd 1 PDNACAlPaEedYiWAhtmQmdYayeoPTorNu seasluneTea_e ri aesESlnt_sI_asANfitNe_Px_ widl Dt_lLu_lidy_dsA_Eoem_to_rod_CEau_eu_bufn_E_lscT_teytd_st_iGI_rictf_bC o_ hlA__kl_ooeK__e_e_Ld_v_aE_A_t_a_mfse_T__l_o_l o__e___ ltu_Or __lo_g__n_1oC__it___e0_awT_p_s0____eOt _____ptri_ _B_en___ePt_Vi__Ecnrl_g__ee_k__Rpg_d__ae_i__ees___tn5_tet__ria___ hssf__s_r2o___oi ep_a__06n___re_n1_5_m cg___ _9a_i0___f_an_0ay_ ___d_ lS_gtE__ae___iguVeS__o l___euRE_t_snPe__taveNt__l e__stenr__Tes__anfe__ ra_s_Bse___imed__eE_e__e__rTGef_QYo_ _e_A n_ro_Ius__ptN_u__Bra_ea___ery__Sr_mL_ent__v__ae_sE_tA_e_nx___itw_ tT__O_It_d_yn_hi___fle6_Fo_le__od__Pb___Tuffe__M___ocEZt___atl_a_Nili_v__bo p_b_a_l_w_Pei_l__ lCe _a_L_ai__n9obs_E__m__0gl _dAe__o0__ __ eu__S___p_n ___E_e_t_____ri__R_s____t___S __a____5_Vb_____5__lP___0e____ ___0 __B___0 _____Y__9p_____0e__S_____r_e__E__t___a_a_P_____cb__T___l_h_e_ ______ 2_s_____7__e_____a___t_ __ 8 11 19 1 13 PM R S V P Finding Her Voice SINiEagCaxunIrImpPtaeW hhiIAVtdero_auDcaOiYisrtvra_atAUMieaieCnzs_oW LenaEn_eiDot_NrNDn_tDda_LcM a_aTSp_aNIltw_Kopt_tCOPeeu_seE_nPLn mea__ Ads_TTdr_b_C_OItsPAO_eh_a_EloeM_rPNa__c Gn_Acg__ShE_A_aYec__e X_l_La_a_ctB_A_or_ k__Y_db_ c__i_ uOD_nCh___t__CiRa_tI_s___hTrwE_c___g_eOD_o__i_e_sB_av_I___hTmEe_m____tRr__C_oyo_____A5u_cc___ _nRo_a__2__nt_Dr0____tdo_1r ____if9_ib___n_ _u _____tEt__e__h__V____ei_E_n_____Na____t__mhT______e___o_B__a__u__E_m__n__G__o_t__I_uN__o___n__f_S__t__ ___oA____f__T _______6_____P______M____________ ______P______L______E______A______S______E_________R_______S______V______P________B______Y__________S_____E___P_T 27 DAWN S PLACE PO BOX 48253 PHILADELPHIA PA 19144 WWW AHOMEFORDAWN ORG

VIRTUA 2018 GALA CONCEPTS AND CREATIVE DESIGNED THROUGH OMEGA HIGH IMPACT PRINT SOLUTIONS A257007 Virtua_2018_EntrancewaysAndInteriors indd 1 A257007 Virtua_2018_EntrancewaysAndInteriors indd 3 A257007 Virtua_2018_EntrancewaysAndInteriors indd 5 2 6 18 2 54 PM A257007 Virtua_2018_EntrancewaysAndInteriors indd 2 2 6 18 2 54 PM A257007 Virtua_2018_EntrancewaysAndInteriors indd 4 2 6 18 2 54 PM A257007 Virtua_2018_EntrancewaysAndInteriors indd 6

VIRTUA 2018 GALA CONCEPTS AND CREATIVE DESIGNED THROUGH OMEGA HIGH IMPACT PRINT SOLUTIONS A257007 Virtua_2018_EntrancewaysAndInteriors indd 7 2 6 18 2 55 PM A257007 Virtua_2018_EntrancewaysAndInteriors indd 8 2 6 18 2 54 PM

VIRTUA 2019 GALA CONCEPTS AND CREATIVE DESIGNED THROUGH OMEGA HIGH IMPACT PRINT SOLUTIONS A261622 Virtua_2019_EntrancewaysAndInteriors_Concepts_2 indd 5 A261622 Virtua_2019_EntrancewaysAndInteriors_Concepts_2 indd 3 A261622 Virtua_2019_EntrancewaysAndInteriors_Concepts_2 indd 7 8 13 19 1 11 PM 8 13 19 1 11 PM Pattern Detail 8 13 19 1 11 PM

VIRTUA 2019 GALA CONCEPTS AND CREATIVE DESIGNED THROUGH OMEGA HIGH IMPACT PRINT SOLUTIONS A261622 Virtua_2019_EntrancewaysAndInteriors_Concepts_2 indd 1 A261622 Virtua_2019_EntrancewaysAndInteriors_Concepts_2 indd 9 8 13 19 1 11 PM Pattern Detail Printed on gold metallic substrate 8 13 19 1 11 PM

VIRTUA 2019 GALA CONCEPTS AND CREATIVE DESIGNED THROUGH OMEGA HIGH IMPACT PRINT SOLUTIONS A261622 Virtua_2019_EntrancewaysAndInteriors_Concepts_2 indd 6 A261622 Virtua_2019_EntrancewaysAndInteriors_Concepts_2 indd 8 A261622 Virtua_2019_EntrancewaysAndInteriors_Concepts_2 indd 4 8 13 19 1 11 PM 8 13 19 1 11 PM 8 13 19 1 11 PM

DR PRAGER COMMUNITY DENTAL CREATIVE DESIGNED THROUGH OMEGA HIGH IMPACT PRINT SOLUTIONS